Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_010877422.1 MTH_RS08720 homoserine O-acetyltransferase
Query= SwissProt::D3P9D1 (377 letters) >NCBI__GCF_000008645.1:WP_010877422.1 Length = 319 Score = 85.1 bits (209), Expect = 2e-21 Identities = 66/219 (30%), Positives = 103/219 (47%), Gaps = 29/219 (13%) Query: 18 DDFYFESGRILSPITVAYETYGKLNEKK----DNAILICHALTGSAHAAGYNSPDDQKPG 73 ++F FESG + V Y T GK + DNA++ H +G + + Sbjct: 13 EEFQFESGEKIQEAPVEYRTTGKPSLDDMGVIDNAVIYIHGWSGDCSSVRRIAA------ 66 Query: 74 WWDDMIGPGKAFDTDKYFIICSNFLGSCYGTTGPASIDPSTGKPYGLKFPVFTVKDMVKL 133 + PG A + +F+I + LGS P S PST G FP +T+ DMV Sbjct: 67 ----LTEPGGALEN--FFVISISSLGS------PGSASPST-TAMGKDFPEYTILDMVNF 113 Query: 134 QKKLIDY-LGIEKLLCVAGGSMGGMQALEWAVTFPEKTYSIIPIATAGRITPMAIAFNTI 192 Q++ +D GI K+ V G SMGG QAL+WA +P++ +IP+ T+ ++ + A + Sbjct: 114 QRQFLDEKFGIRKVRGVIGTSMGGFQALQWAAEYPDEMEFLIPLVTSWQVRGINYALFSY 173 Query: 193 GRFAIMKDPNWMNGDYYGKTFPRDGLAIARMAGHITYMS 231 I DP + G T P L++A M ++ +S Sbjct: 174 MNHLIEGDPEFRAG-----TRPERALSLASMLMYLHGLS 207 Lambda K H 0.321 0.140 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 319 Length adjustment: 29 Effective length of query: 348 Effective length of database: 290 Effective search space: 100920 Effective search space used: 100920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory