Align Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PPRibP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 (characterized)
to candidate WP_010936212.1 DET_RS02375 ribose-phosphate diphosphokinase
Query= SwissProt::P14193 (317 letters) >NCBI__GCF_000011905.1:WP_010936212.1 Length = 324 Score = 332 bits (850), Expect = 1e-95 Identities = 166/308 (53%), Positives = 223/308 (72%), Gaps = 1/308 (0%) Query: 10 LKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGEVQINIEESIRGCDCYIIQSTSDPV 69 LKIF+ N+NP+LAK +AD + VQ+GKC V +FS+ + + I+ES+R D Y+IQ T PV Sbjct: 11 LKIFTGNANPDLAKAVADYLKVQMGKCEVFQFSNENIFVRIQESVRKKDVYVIQPTCSPV 70 Query: 70 NEHIMELLIMVDALKRASAKTINIVIPYYGYARQDRKARSREPITAKLFANLLETAGATR 129 N+ IMELLIM+DALKRAS++ I V+PYYGY R D+K + R PITA+L A+LL AGA+R Sbjct: 71 NQSIMELLIMMDALKRASSERITAVLPYYGYGRTDKKDQPRVPITARLIADLLTAAGASR 130 Query: 130 VIALDLHAPQIQGFFDIPIDHLMGVPILGEYFEGKNLEDIVIVSPDHGGVTRARKLADRL 189 ++ LDLHAPQIQGFFD+P+D L +L YF+ K LED+V+V+ D G +AR A +L Sbjct: 131 ILTLDLHAPQIQGFFDMPVDELTAENLLANYFKKKKLEDLVVVATDVGISKKARDFAAKL 190 Query: 190 KAPIAIIDKRRPRPN-VAEVMNIVGNIEGKTAILIDDIIDTAGTITLAANALVENGAKEV 248 AP+AII+KRR N + +NI+G++EGK A+ DD IDTAG++ N L+ G KEV Sbjct: 191 DAPLAIIEKRRMGNNDITRTINIIGDVEGKNALTFDDEIDTAGSLVGNVNILINKGVKEV 250 Query: 249 YACCTHPVLSGPAVERINNSTIKELVVTNSIKLPEEKKIERFKQLSVGPLLAEAIIRVHE 308 Y+C THPVLSGPA++RI S IKELVVT+SI L KKI++ LS+ PL+ EAI R+H Sbjct: 251 YSCATHPVLSGPAIQRIAASPIKELVVTDSIPLTPPKKIDKITVLSIAPLIGEAIYRIHT 310 Query: 309 QQSVSYLF 316 S+ ++ Sbjct: 311 GNSIGEMY 318 Lambda K H 0.319 0.137 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 324 Length adjustment: 28 Effective length of query: 289 Effective length of database: 296 Effective search space: 85544 Effective search space used: 85544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_010936212.1 DET_RS02375 (ribose-phosphate diphosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.29600.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-115 370.9 0.3 2.3e-115 370.7 0.3 1.0 1 lcl|NCBI__GCF_000011905.1:WP_010936212.1 DET_RS02375 ribose-phosphate dip Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000011905.1:WP_010936212.1 DET_RS02375 ribose-phosphate diphosphokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 370.7 0.3 2.3e-115 2.3e-115 2 309 .] 12 319 .. 11 319 .. 0.98 Alignments for each domain: == domain 1 score: 370.7 bits; conditional E-value: 2.3e-115 TIGR01251 2 kilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmelll 70 ki+ g+++++la++va++l++++g++ev +F+++++ vri+esvr kdv++i q t+ pvn+++mell+ lcl|NCBI__GCF_000011905.1:WP_010936212.1 12 KIFTGNANPDLAKAVADYLKVQMGKCEVFQFSNENIFVRIQESVRKKDVYVI-QPTCSPVNQSIMELLI 79 89**************************************************.9*************** PP TIGR01251 71 lidalkrasaksvtaviPyygYaRqdkkaksrepisaklvaklleeaGadrvltvdlHseqiqgfFdvp 139 ++dalkras +++tav+PyygY+R dkk+++r pi+a+l+a+ll++aGa+r+lt+dlH++qiqgfFd+p lcl|NCBI__GCF_000011905.1:WP_010936212.1 80 MMDALKRASSERITAVLPYYGYGRTDKKDQPRVPITARLIADLLTAAGASRILTLDLHAPQIQGFFDMP 148 ********************************************************************* PP TIGR01251 140 venlsaspklieelkkkelknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnllgdv 208 v++l+a++ l++++kkk+l++lvvv+ D G + a+++a+kl+++laiieK+R ++ +++n++gdv lcl|NCBI__GCF_000011905.1:WP_010936212.1 149 VDELTAENLLANYFKKKKLEDLVVVATDVGISKKARDFAAKLDAPLAIIEKRRMGNNDITRTINIIGDV 217 ******************************************************666666799****** PP TIGR01251 209 egkdvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeagveevivtntilvee. 276 egk+++ +DD i+T+g+lv +++L +kG k+v+ +ath+v+sg+A++r+a + ++e++vt++i+ + lcl|NCBI__GCF_000011905.1:WP_010936212.1 218 EGKNALTFDDEIDTAGSLVGNVNILINKGVKEVYSCATHPVLSGPAIQRIAASPIKELVVTDSIPLTPp 286 ******************************************************************666 PP TIGR01251 277 kklpkvseisvapliaeaiarihenesvsslfd 309 kk++k++++s+apli eai rih+++s+ +++d lcl|NCBI__GCF_000011905.1:WP_010936212.1 287 KKIDKITVLSIAPLIGEAIYRIHTGNSIGEMYD 319 ****************************99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (324 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.87 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory