Align N-acetylglutamate synthase (EC 2.3.1.1) (characterized)
to candidate WP_010936234.1 DET_RS02480 GNAT family N-acetyltransferase
Query= reanno::DvH:207038 (154 letters) >NCBI__GCF_000011905.1:WP_010936234.1 Length = 158 Score = 141 bits (355), Expect = 5e-39 Identities = 67/150 (44%), Positives = 93/150 (62%), Gaps = 1/150 (0%) Query: 5 IRKATVPDVKRIHAILMECAGQRLLLPRSLNDLYSRIRDFVVVDADEGGAILGCCALSIT 64 I KAT+ D IH ++ A +L RSL ++Y +RDF V+ D G ++ C AL I+ Sbjct: 4 IDKATIKDATTIHKLVNNFADHGQMLARSLAEIYENLRDFYVIRGDNG-EVIACAALHIS 62 Query: 65 WEDIAEIRSLVVLESLRGQGWGRRLVEACMSDAVTLGLYRVFTLTYQVEFFNKLGYSVVG 124 W D+AE++SL V E QG G +V+AC+ DA +L + VF LTY+ FF K G+ V Sbjct: 63 WADLAEVKSLAVSEERHRQGLGEMVVKACLEDAKSLQIPTVFCLTYKPAFFAKCGFHQVE 122 Query: 125 KEVLPQKVWADCIHCPQFPECDETAMLIEL 154 K LP K+W +C CP+FP CDETAM++ L Sbjct: 123 KNALPHKIWGECYRCPKFPNCDETAMMLSL 152 Lambda K H 0.327 0.142 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 90 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 154 Length of database: 158 Length adjustment: 17 Effective length of query: 137 Effective length of database: 141 Effective search space: 19317 Effective search space used: 19317 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory