Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_010936238.1 DET_RS02500 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000011905.1:WP_010936238.1 Length = 358 Score = 218 bits (555), Expect = 2e-61 Identities = 121/359 (33%), Positives = 201/359 (55%), Gaps = 11/359 (3%) Query: 7 LKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKHIME 66 L LR +ID LD ++ L+++R + ++ +VK + ++ RE+ VL + Sbjct: 3 LSDLRKQIDELDAELVKLMAKRLEVSDQIGKVKEETNSPVQDL-----SRESEVLNRVQS 57 Query: 67 LNKG-PLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPMA 125 L + LD +++ L++EI+ +Q VA+ G G +S+ ALK FG + ++ P Sbjct: 58 LARSLGLDPQDIESLYQEILFISKK-QQRFTVAFQGAAGAYSEETALKIFGPNTLALPYE 116 Query: 126 AIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGET 185 +D F V G F VVPVENS EG+++ T D + ++++ E ELR+ H L+ Sbjct: 117 QLDGAFEAVEKGMARFAVVPVENSLEGSISRTYDLLFDSNLMVAAEHELRVSHCLIANPE 176 Query: 186 TKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEW--NSAAIAGDM 243 T + + IYSH Q+L QC+ +L + E + A + K +K + + AAIA + Sbjct: 177 TTLEGVKTIYSHPQALGQCQSFLK--HLRAELIPAYDTAGSVKMIKEKHLLDGAAIASER 234 Query: 244 AAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMPF 303 AA +Y + L +IED N TRF ++ Q+ P+G+DKTS++ +++++ GAL++ + Sbjct: 235 AAVIYNMKVLEREIEDNINNYTRFFVLAKQDSAPSGNDKTSVVFAVKHEAGALYDFIKEL 294 Query: 304 HSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYPK 362 S I++T++E+RP+R W Y F++D GH QD IK L K + +KVLGSYPK Sbjct: 295 ASRKINMTKLESRPTRLKPWEYNFYLDIEGHRQDENIKQALAKAEDHVIFMKVLGSYPK 353 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 358 Length adjustment: 29 Effective length of query: 336 Effective length of database: 329 Effective search space: 110544 Effective search space used: 110544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_010936238.1 DET_RS02500 (prephenate dehydratase)
to HMM PF01817 (CM_2)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF01817.25.hmm # target sequence database: /tmp/gapView.24325.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: CM_2 [M=79] Accession: PF01817.25 Description: Chorismate mutase type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-27 79.8 2.3 1.9e-26 78.6 2.3 1.7 1 lcl|NCBI__GCF_000011905.1:WP_010936238.1 DET_RS02500 prephenate dehydrata Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000011905.1:WP_010936238.1 DET_RS02500 prephenate dehydratase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 78.6 2.3 1.9e-26 1.9e-26 1 78 [. 7 84 .. 7 85 .. 0.99 Alignments for each domain: == domain 1 score: 78.6 bits; conditional E-value: 1.9e-26 CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreii 71 Rk+Ide+D+el++L+a+R+e++++i+++K+e++ pv d +Re evl+r+++ a++lgldp+ +e++++ei+ lcl|NCBI__GCF_000011905.1:WP_010936238.1 7 RKQIDELDAELVKLMAKRLEVSDQIGKVKEETNSPVQDLSRESEVLNRVQSLARSLGLDPQDIESLYQEIL 77 9********************************************************************** PP CM_2 72 sesralQ 78 s+++Q lcl|NCBI__GCF_000011905.1:WP_010936238.1 78 FISKKQQ 84 *****99 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (79 nodes) Target sequences: 1 (358 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.88 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory