Align phosphoserine aminotransferase monomer (EC 2.6.1.1; EC 2.6.1.52) (characterized)
to candidate WP_010936375.1 DET_RS03175 alanine--glyoxylate aminotransferase family protein
Query= metacyc::MONOMER-15919 (385 letters) >NCBI__GCF_000011905.1:WP_010936375.1 Length = 362 Score = 278 bits (712), Expect = 1e-79 Identities = 153/359 (42%), Positives = 221/359 (61%), Gaps = 2/359 (0%) Query: 10 LMIPGPTMVPPEVLNAMALPVIGHRTKDYSNLLEDTIEKLKKVFITENDTFLITGSGTAA 69 L IPGPT P EVL AM +I HR + + ++++ EKLK F T+ND ++TGSGT Sbjct: 4 LRIPGPTPCPEEVLTAMGQQMINHRGPEMAAIMKEVAEKLKYFFQTKNDVLVLTGSGTGG 63 Query: 70 MDMAISNIIKRGDKVLNIVTGNFGERFANIVKAYKGEAIRLDVEWGDMAEPEAVKEILDK 129 ++ A N + G+ VL++ G FGERFA I + + I L+ E G A+P VK+ L + Sbjct: 64 LEAAAVNFLSPGETVLSVSIGVFGERFAKIASIFGAKIIALNFEHGKAADPALVKKALAE 123 Query: 130 YDDIKAVTVVHNETSTGARNPIKEIGEVVKDYDALYIVDTVSSLGGDYVNVDKFHIDICV 189 + +IKAV + HNETSTG N +K + VVK L +VD +SSL + VD++ D+ V Sbjct: 124 HPEIKAVLITHNETSTGITNDLKSLASVVKGAGKLLMVDAISSLSSIDLPVDEWGCDVVV 183 Query: 190 TGSQKCLAAPPGLAAITVSEKAWEVIKKNDDKVGFYLDLLAYKKYYEEKKQTPYTPSVNL 249 +GSQK PPGLA I+VS AW+ FY DL +K EK QTP+TP V++ Sbjct: 184 SGSQKGWMVPPGLAFISVSPDAWKA-NAESKMPRFYWDLAKHKASI-EKGQTPWTPCVSV 241 Query: 250 TYALNVALDLVLEEGIENRVKRHERLAKATRAGLEAMGIELFAKERARSVTVTSAKYPEG 309 AL+ AL ++ +EG++N KRH+++A TR G++ +G+ L A+E+ S TVT+ EG Sbjct: 242 IVALHKALAMMEKEGMQNIFKRHQKIADFTRKGVKELGLTLLAEEKYASNTVTAVLATEG 301 Query: 310 IEDSKFRGILSNKYNIVVAGGQKHLAGKIFRIGHMGICGEKEVLATLACVELALKELGF 368 ++ K ++ +YN V+AGGQ L GKIFRIGH+G E ++ TL ++LAL + GF Sbjct: 302 LDPKKLLKVMREEYNTVLAGGQGPLEGKIFRIGHLGWVTENDIKVTLDNLKLALPKAGF 360 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 362 Length adjustment: 30 Effective length of query: 355 Effective length of database: 332 Effective search space: 117860 Effective search space used: 117860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory