Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate WP_010961801.1 MCA_RS12670 anthranilate phosphoribosyltransferase
Query= SwissProt::Q8PD71 (345 letters) >NCBI__GCF_000008325.1:WP_010961801.1 Length = 341 Score = 319 bits (817), Expect = 7e-92 Identities = 173/337 (51%), Positives = 223/337 (66%), Gaps = 1/337 (0%) Query: 7 QALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGAATVMRE 66 + L+ + +++ M + MR+IM G + A + A L LR K ET+ E+A AA V+RE Sbjct: 5 EVLETLLAGKDLSPSAMRETMRKIMSGGATPAQIGAFLIALRCKGETVEEVAAAAQVLRE 64 Query: 67 FSRRVEVTDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGNRSVSSKSGSAD 126 + +V V+ H++D GTGGD S TFNIST A FV AA G +VAKHG+RSVS +SGSAD Sbjct: 65 MATKVPVS-APHLLDTCGTGGDASKTFNISTTAAFVVAAAGGRVAKHGSRSVSGRSGSAD 123 Query: 127 ALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGVRTIFNILGPLT 186 LEA G IEL P+QV + G+GF++A HH AMK RRE+GVRT+FN+LGPLT Sbjct: 124 VLEAAGINIELTPDQVKTCIETLGVGFLFAQRHHGAMKYAIGPRRELGVRTLFNLLGPLT 183 Query: 187 NPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVGELRDGQ 246 NPAG+PN L+GV+ V ARVLQ+LG+ LVV DG+DE+S+ A T V EL++G Sbjct: 184 NPAGAPNQLVGVYTDPWVEGLARVLQQLGSSHVLVVHAEDGLDEISIAAPTHVAELKNGL 243 Query: 247 VHEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQVLDNVPGPALDIVALNAGAALYVAG 306 + Y V PE FG +A L + A S M+ VLDNVPGPA DIVALNAGAA+Y A Sbjct: 244 ITNYYVRPEQFGFRRAALSELAIDTVAASLKMMRGVLDNVPGPARDIVALNAGAAIYAAD 303 Query: 307 VADSIADGIVRARQVLADGSARACLDAYVAFTQQATA 343 + DS+ GI RA V+ADGSARA L+A A ++Q A Sbjct: 304 LTDSLEAGIRRAEAVIADGSARAKLEALAALSRQFAA 340 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 341 Length adjustment: 29 Effective length of query: 316 Effective length of database: 312 Effective search space: 98592 Effective search space used: 98592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_010961801.1 MCA_RS12670 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.19673.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-125 404.6 0.4 2e-125 404.4 0.4 1.0 1 lcl|NCBI__GCF_000008325.1:WP_010961801.1 MCA_RS12670 anthranilate phospho Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000008325.1:WP_010961801.1 MCA_RS12670 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 404.4 0.4 2e-125 2e-125 1 329 [. 7 333 .. 7 334 .. 0.99 Alignments for each domain: == domain 1 score: 404.4 bits; conditional E-value: 2e-125 TIGR01245 1 leklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekeese 69 le+ll +kdLs +++ m++imsg a++aqi+A+l+alr kget+ee+a++a++lre a+kv+++ + lcl|NCBI__GCF_000008325.1:WP_010961801.1 7 LETLLAGKDLSPSAMRETMRKIMSGGATPAQIGAFLIALRCKGETVEEVAAAAQVLREMATKVPVS-AP 74 57899************************************************************5.9* PP TIGR01245 70 elvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnlelspekvarsl 138 +l+D++GTGGD++kt+NiST++a+v+aaaG +vaKhG+rsvs++sGsaDvLea g+n+el+p++v+ ++ lcl|NCBI__GCF_000008325.1:WP_010961801.1 75 HLLDTCGTGGDASKTFNISTTAAFVVAAAGGRVAKHGSRSVSGRSGSADVLEAAGINIELTPDQVKTCI 143 ********************************************************************* PP TIGR01245 139 eevgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlvevlaevlknlg 207 e++g+gFlfA ++h a+k++++ R+eLgvrt+fNlLGPL+nPa a++q++Gvy ve la+vl++lg lcl|NCBI__GCF_000008325.1:WP_010961801.1 144 ETLGVGFLFAQRHHGAMKYAIGPRRELGVRTLFNLLGPLTNPAGAPNQLVGVYTDPWVEGLARVLQQLG 212 ********************************************************************* PP TIGR01245 208 vkralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsaeenaellkevle 276 ++++lvvh+edglDEis+ ++t+vaelk+g i++y+++pe+fg+ ra l+el++++ ++++++++ vl lcl|NCBI__GCF_000008325.1:WP_010961801.1 213 SSHVLVVHAEDGLDEISIAAPTHVAELKNGLITNYYVRPEQFGFRRAALSELAIDTVAASLKMMRGVLD 281 ********************************************************************9 PP TIGR01245 277 gkekkakrdivvlNaaaalyvagkakdlkegvelakeaiksgkalekleelva 329 + +++rdiv+lNa+aa+y+a+ +++l++g+++a+++i +g+a +kle+l+a lcl|NCBI__GCF_000008325.1:WP_010961801.1 282 NVP-GPARDIVALNAGAAIYAADLTDSLEAGIRRAEAVIADGSARAKLEALAA 333 988.999*****************************************99875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (341 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.76 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory