Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate WP_010961983.1 MCA_RS13615 acetylglutamate kinase
Query= BRENDA::Q9HTN2 (301 letters) >NCBI__GCF_000008325.1:WP_010961983.1 Length = 300 Score = 395 bits (1014), Expect = e-115 Identities = 196/291 (67%), Positives = 244/291 (83%), Gaps = 2/291 (0%) Query: 8 AAQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHG 67 A ++A VL+EALPYIRRF G+T+V+KYGGNAM + LK FARDVVL+K VGINPVVVHG Sbjct: 12 ANRIAHVLTEALPYIRRFKGRTIVVKYGGNAMIDDHLKNSFARDVVLLKLVGINPVVVHG 71 Query: 68 GGPQIGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLT 127 GGPQIG+LL+RL S F+ GMRVTDA TMDVVEMVLGG VNK+IVNLINR GG+A+GL+ Sbjct: 72 GGPQIGNLLQRLGKTSEFVQGMRVTDAETMDVVEMVLGGLVNKEIVNLINRQGGAAVGLS 131 Query: 128 GKDAELIRAKKLTVTRQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGV 187 GKD +LIRA+K+ +++ P PEIID+GHVGEV ++ +++MLV GDFIPVIAPIGV Sbjct: 132 GKDGDLIRARKIRMSQ--PLSDAPEIIDLGHVGEVASIDPAVVDMLVNGDFIPVIAPIGV 189 Query: 188 GSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGT 247 G +G SYNINADLVAGK+AE LKAEKL+LLTN G++ + G +LTGLS ++V+ LI DGT Sbjct: 190 GEDGCSYNINADLVAGKMAEVLKAEKLILLTNTQGILGRDGALLTGLSLKEVDALIEDGT 249 Query: 248 IYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISNR 298 I GGM+PK+RCA++A++GGV SAHIIDGR+ +AVLLE+FTD G+GTL+ R Sbjct: 250 ISGGMIPKVRCAMDALRGGVNSAHIIDGRIDHAVLLELFTDQGIGTLLLRR 300 Lambda K H 0.318 0.138 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 300 Length adjustment: 27 Effective length of query: 274 Effective length of database: 273 Effective search space: 74802 Effective search space used: 74802 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_010961983.1 MCA_RS13615 (acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00761.hmm # target sequence database: /tmp/gapView.3797083.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00761 [M=231] Accession: TIGR00761 Description: argB: acetylglutamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-80 255.5 3.9 2.6e-80 255.3 3.9 1.0 1 NCBI__GCF_000008325.1:WP_010961983.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000008325.1:WP_010961983.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 255.3 3.9 2.6e-80 2.6e-80 1 231 [] 33 274 .. 33 274 .. 0.98 Alignments for each domain: == domain 1 score: 255.3 bits; conditional E-value: 2.6e-80 TIGR00761 1 tiViKiGGaais..elleelakdiaklrkegiklvivHGGgpeinelleklgievefvnglRvTdketlevve 71 tiV+K+GG+a+ +l++++a+d++ l+ +gi++v+vHGGgp+i +ll++lg efv+g+RvTd+et++vve NCBI__GCF_000008325.1:WP_010961983.1 33 TIVVKYGGNAMIddHLKNSFARDVVLLKLVGINPVVVHGGGPQIGNLLQRLGKTSEFVQGMRVTDAETMDVVE 105 69*********988899******************************************************** PP TIGR00761 72 mvligkvnkelvallekhgikavGltgkDgqlltaekldke..........dlgyvGeikkvnkelleallka 134 mvl g vnke+v+l++++g +avGl+gkDg+l+ a+k+ + dlg+vGe+ ++++++++ l++ NCBI__GCF_000008325.1:WP_010961983.1 106 MVLGGLVNKEIVNLINRQGGAAVGLSGKDGDLIRARKIRMSqplsdapeiiDLGHVGEVASIDPAVVDMLVNG 178 ************************************8888778999*************************** PP TIGR00761 135 giipviaslaldeegqllNvnaDtaAaelAaaleAekLvlLtdvaGilegdkksliseleleeieqlikqavi 207 ++ipvia++++ e+g +N+naD +A+++A++l+AekL+lLt+++Gil +d++ l++ l+l+e++ li+ + i NCBI__GCF_000008325.1:WP_010961983.1 179 DFIPVIAPIGVGEDGCSYNINADLVAGKMAEVLKAEKLILLTNTQGILGRDGA-LLTGLSLKEVDALIEDGTI 250 **************************************************888.******************* PP TIGR00761 208 kgGmipKveaalealesgvkkvvi 231 gGmipKv++a++al++gv++++i NCBI__GCF_000008325.1:WP_010961983.1 251 SGGMIPKVRCAMDALRGGVNSAHI 274 **********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (300 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 22.10 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory