Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (uncharacterized)
to candidate WP_010965942.1 CA_RS13575 aspartate carbamoyltransferase
Query= curated2:Q92BC1 (316 letters) >NCBI__GCF_000008765.1:WP_010965942.1 Length = 307 Score = 120 bits (301), Expect = 4e-32 Identities = 97/313 (30%), Positives = 152/313 (48%), Gaps = 22/313 (7%) Query: 11 GKDMLSLLEWNKEELIDIIKLAVAMKTNPAHYSHILSGKILGMIFDKPSTRTRVSFEAGI 70 G+ ++ +++ +EL +I KLA + P Y H GKIL +F +PSTRTR SFE + Sbjct: 4 GRSLIDPMDFTVDELEEIFKLADDIIACPKEYMHAAEGKILATLFYEPSTRTRFSFETAM 63 Query: 71 LQLGGQAIVMSS-KELQIGRGEPIKDTAHVMSEYIDAIMIRTFSHEKVEELAYHAEIPII 129 L+LGGQ + S + +GE I DT V+S Y D +R + + ++ IP+I Sbjct: 64 LRLGGQVVGFSEPNSSSVSKGETIADTIRVVSCYADIAAMRHPKEGAPKVASMYSSIPVI 123 Query: 130 NGLTDLH-HPCQALADLMTIYEWKDQLEGVKLAYIGD---GNNVCHSLLLAGAMVGLD-I 184 N H HP Q L DL+T+ K +L + + GD G V HSL+ A + + I Sbjct: 124 NAGDGGHQHPTQTLTDLLTMRRTKKRLSNLTIGMCGDLKFGRTV-HSLIKAMSRYDNNKI 182 Query: 185 RLAMPKGYEVDETI---LATAENLAKESGAKIFVTEDPKHAVTDADFIY-TDVWTSMGQE 240 L P +V E I + N+ + +I + + + D +Y T V Sbjct: 183 VLISPDELKVPEYIKKEILDKNNIEYKEAKRI------EDVIEELDVLYMTRVQKERFFN 236 Query: 241 EENAKRLADFGEKYQVNAELASIAKPDYHFLHCLPAHREEEVTAEIIDGNHSVIYQQAGN 300 EE+ RL D Y +N AK D LH LP R E++ E+ + + ++QA N Sbjct: 237 EEDYIRLKD---SYILNENKLKTAKKDMIILHPLP--RVNEISYEVDNDERAYYFKQAKN 291 Query: 301 RLHAQKALLAAIL 313 ++ + AL+A ++ Sbjct: 292 GMYVRMALMAKLM 304 Lambda K H 0.317 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 307 Length adjustment: 27 Effective length of query: 289 Effective length of database: 280 Effective search space: 80920 Effective search space used: 80920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory