Align Imidazoleglycerol-phosphate dehydratase; IGPD; EC 4.2.1.19 (characterized)
to candidate WP_011020277.1 MA_RS01180 imidazoleglycerol-phosphate dehydratase
Query= SwissProt::P9WML9 (210 letters) >NCBI__GCF_000007345.1:WP_011020277.1 Length = 191 Score = 169 bits (429), Expect = 2e-47 Identities = 94/201 (46%), Positives = 126/201 (62%), Gaps = 12/201 (5%) Query: 11 RRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEI 70 R RI R+T+E+DI +EL+LDG G + TG+ F+DHML + H+ FDL VRA GD+ + Sbjct: 2 RTGRISRKTKETDIQLELNLDGKGVADISTGLGFFDHMLASFSRHSEFDLKVRAEGDLYV 61 Query: 71 EAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEP 130 + HH +ED I LG AL + LGD GI RFG+A IPMDE LA A+D+ GR Y V E Sbjct: 62 DEHHLVEDVGIVLGRALAEVLGDMSGIARFGEARIPMDEALAEVALDVGGRNYLVLKAE- 120 Query: 131 DHLQHTTIAGSSV-PYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARA 189 A V + T + RH FE+LA+NA+I +H V YG + HH EA +KA A A Sbjct: 121 -------FASPQVGQFSTQLVRHFFETLASNAKITMHASV-YGDNDHHKIEALFKAFAYA 172 Query: 190 LRQAVEPDPRVSGVPSTKGAL 210 +++AV+ + + V STKG L Sbjct: 173 MKRAVKIEGK--EVKSTKGTL 191 Lambda K H 0.319 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 119 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 210 Length of database: 191 Length adjustment: 21 Effective length of query: 189 Effective length of database: 170 Effective search space: 32130 Effective search space used: 32130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory