Align 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; EC 5.3.1.16; Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (uncharacterized)
to candidate WP_011020590.1 MA_RS02840 imidazole glycerol phosphate synthase cyclase subunit
Query= curated2:Q2S296 (258 letters) >NCBI__GCF_000007345.1:WP_011020590.1 Length = 273 Score = 107 bits (267), Expect = 3e-28 Identities = 82/267 (30%), Positives = 127/267 (47%), Gaps = 35/267 (13%) Query: 4 VIPAIDI---RDGRCVRLHQGDYDNETVYFEDPVKMAKLWRVQNAQTLHVVDLDAARGEG 60 +IP +D+ R G CV D + DPV++AK + A L +D+ A+ Sbjct: 6 IIPCLDVTLDRAGGCVVKGVEFVDLKEA--GDPVELAKRYNEDGADELVFLDITASAHGR 63 Query: 61 EHNRDVIGKMCDALDIPIQLGGGIRSMDQIEAALDRGVYRVILGTAAVRNPDFVERAVEQ 120 E DVI + D + IP+ +GGGI S+D I L G +V + T+AV+NPDF++ + + Sbjct: 64 ETMIDVIERTADEVFIPLTVGGGISSIDAIRQILRAGADKVSVNTSAVKNPDFIKESSDI 123 Query: 121 FSARRVVVSIDAR-----------------DG-----EVRVQGWTEGSGLDAVAFAKDME 158 F A+ +V +ID R DG EV + G E +G+DAV +AK E Sbjct: 124 FGAQCIVTAIDCRRNTDIKNNPDKTVLELEDGTPAWYEVVIYGGREATGIDAVQWAKKAE 183 Query: 159 QRGVRRLVYTDISRDGTMDGPNIQAYRTLGRQLAHAKVTASGGVGEHDDLLDIQTLQPYG 218 + G ++ T + RDGT G ++ R L +L + ASGGVG + + G Sbjct: 184 ELGSGEILLTSMDRDGTCAGYDLPITRKLSEEL-DIPIIASGGVGNPQHIYE-------G 235 Query: 219 VDSVIVGTALYENRFPCQQFWAWQDKD 245 AL + F ++ W+ K+ Sbjct: 236 FSEGKADAALAASIFHFSEYSIWEVKE 262 Score = 23.9 bits (50), Expect = 0.004 Identities = 18/96 (18%), Positives = 37/96 (38%) Query: 32 DPVKMAKLWRVQNAQTLHVVDLDAARGEGEHNRDVIGKMCDALDIPIQLGGGIRSMDQIE 91 D V+ AK + + + +D ++ + K+ + LDIPI GG+ + I Sbjct: 174 DAVQWAKKAEELGSGEILLTSMDRDGTCAGYDLPITRKLSEELDIPIIASGGVGNPQHIY 233 Query: 92 AALDRGVYRVILGTAAVRNPDFVERAVEQFSARRVV 127 G L + ++ V+++ R + Sbjct: 234 EGFSEGKADAALAASIFHFSEYSIWEVKEYLREREI 269 Lambda K H 0.321 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 218 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 258 Length of database: 273 Length adjustment: 25 Effective length of query: 233 Effective length of database: 248 Effective search space: 57784 Effective search space used: 57784 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory