Align lysyltransferase (EC 2.3.2.3); [amino group carrier protein]-L-2-aminoadipate ligase (EC 6.3.2.43); glutamate---[amino group carrier protein] ligase (EC 6.3.2.60) (characterized)
to candidate WP_011032065.1 MM_RS00550 tetrahydromethanopterin:alpha-L-glutamate ligase
Query= BRENDA::Q5JFW0 (273 letters) >NCBI__GCF_000007065.1:WP_011032065.1 Length = 324 Score = 105 bits (262), Expect = 1e-27 Identities = 80/230 (34%), Positives = 119/230 (51%), Gaps = 26/230 (11%) Query: 42 DLDVVIIRNVSH--FKALY----TARLFESEGIPTVNSSRLIFEAGDKLFATLRLA-GKV 94 DLD +I+R+V F+ + R E+EG+ +NS I A +K A+ LA + Sbjct: 62 DLDALIVRDVGAGAFEGVSFRFDILRELEAEGVSVINSPEAIQNAANKYHASYLLAKAGL 121 Query: 95 PVPEWKAALSEGGALRVPDSLGYPLVSKPVFGSWGRLLAKVNDRD-----------SLEA 143 PVPE A S AL+V G ++ KPVFG G+ +A+V +R+ +E Sbjct: 122 PVPETVAVQSLEAALKVISEFGDAVI-KPVFGYKGKDIARVKNREIRFSDRKIEPAPVEE 180 Query: 144 VLEHRKWMKNPLYGIHYFQEFVEKPGRDIRSYVIGGEFVGAIYR--YSNHWITNTARGGK 201 +LE K G+ Y QEF+E PGRDIR++V+GG +GAIYR + W+ N ++GG Sbjct: 181 ILEKLLEEK----GMLYIQEFIENPGRDIRAFVVGGTAIGAIYRKAAAGSWVNNLSQGGS 236 Query: 202 AEPC-SDPEVEELSVKAWEAFGEGALAIDIFESEKGLLVNEVNPNMEFKN 250 ++ C E E+++ KA A G IDI E + N+ M +N Sbjct: 237 SDRCVLTDEQEKIAEKASLALGTTFAGIDIIEGTEESEENKKTEGMSSEN 286 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 324 Length adjustment: 26 Effective length of query: 247 Effective length of database: 298 Effective search space: 73606 Effective search space used: 73606 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory