Align shikimate kinase (EC 2.7.1.71) (characterized)
to candidate WP_011156072.1 TX73_RS02615 shikimate kinase
Query= reanno::Caulo:CCNA_03103 (200 letters) >NCBI__GCF_000195775.1:WP_011156072.1 Length = 203 Score = 182 bits (462), Expect = 4e-51 Identities = 94/187 (50%), Positives = 126/187 (67%) Query: 9 DTAPEAAPEVAPIVSDDLAPLRAKTIVLVGLMGVGKSSVGRRLANVLGLPFRDADNEVEA 68 +T P AA +P ++ +A L + +VL+G+MG GKS+VGRRLA LGLPF DAD E+E+ Sbjct: 6 ETVPTAAAGRSPQEAEIVAALGDRPVVLIGMMGAGKSTVGRRLALRLGLPFLDADTEIES 65 Query: 69 AAGRSISEIFAELGEPAFRDGERRVIARLLDEPPHVLATGGGAFVNAETRALINEKAVSV 128 AA +I EIF GEP FRDGE RVI+RLLD VLATGGGAF+ ETR I EKA+S+ Sbjct: 66 AAAMTIPEIFETHGEPHFRDGEARVISRLLDGGTKVLATGGGAFMREETRDRIREKAISM 125 Query: 129 WLKADVELLARRVSRKDNRPLVRGKDPVKVLTELAEARYPAYAEAQVHVETGDTPHMVAV 188 WL+A+ +++ RRV R+ +RPL++ DP + L RYP Y EA + + + D PH V Sbjct: 126 WLEAEADVILRRVKRRADRPLLKTPDPAGTIARLIAERYPLYREADITIASRDVPHEKIV 185 Query: 189 EAILTAL 195 + + AL Sbjct: 186 DECVAAL 192 Lambda K H 0.316 0.132 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 200 Length of database: 203 Length adjustment: 21 Effective length of query: 179 Effective length of database: 182 Effective search space: 32578 Effective search space used: 32578 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory