Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_011159234.1 TX73_RS18870 prephenate dehydratase
Query= SwissProt::P57472 (385 letters) >NCBI__GCF_000195775.1:WP_011159234.1 Length = 280 Score = 135 bits (340), Expect = 1e-36 Identities = 85/274 (31%), Positives = 145/274 (52%), Gaps = 12/274 (4%) Query: 107 SFLGPKGSYSHIA---AYKYADLNFQKCITNECSTFEEVVLSVENNQSDYAVLPIENTCS 163 +F G G+ SHIA AY A+ C+TFE+ + ++ + ++D ++PIEN+ + Sbjct: 4 AFQGEPGANSHIAISDAYPTAE-------AMPCATFEDALSAISSGEADLGMIPIENSVA 56 Query: 164 GSINEVFDILKKTNLFIIGEINIFINHNLLTLKKIELNKIKTIYSHPQPFQQCSDFIKKF 223 G + ++ +L + LFI+GE + I H L+ + +L IKT+ SH QC I+KF Sbjct: 57 GRVADIHHLLPTSKLFIVGEWFLPIRHQLVAVPGAKLEDIKTVESHVHALGQCRRIIRKF 116 Query: 224 PEWKIKYTKSTADAMKKIKKYNDVTNAALGSEIGSKIYGLEILMKNLANKENNITRFILL 283 K TA + + I + D T AA+ S + +KIYGL+IL +++ ++ +N TRF++L Sbjct: 117 -GLKPIVAGDTAGSARIIAERGDKTCAAISSRLAAKIYGLDILAEDIEDEAHNTTRFVVL 175 Query: 284 NRNPK-KISKNIPTTTTLIFTTGQEAGSLSKVLSILQEKKLIMKKLTSQKIYKNPWEEMF 342 R P+ + + TT +F +L K L + M KL S + N + F Sbjct: 176 AREPRWAVQGSGKLVTTFVFRVRNLPAALYKALGGFATNGVNMTKLESYMVDGNFFATQF 235 Query: 343 YIDIQVNLSSTLMQDALEKIKKITRFIKILGCYP 376 Y D++ + + AL+++K +R +I+G YP Sbjct: 236 YADVEGHPEDRNLAFALDELKFFSREFRIVGVYP 269 Lambda K H 0.318 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 280 Length adjustment: 28 Effective length of query: 357 Effective length of database: 252 Effective search space: 89964 Effective search space used: 89964 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory