Align Aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate WP_011159973.1 TX73_RS22675 histidinol-phosphate transaminase
Query= reanno::BFirm:BPHYT_RS14905 (370 letters) >NCBI__GCF_000195775.1:WP_011159973.1 Length = 365 Score = 231 bits (589), Expect = 2e-65 Identities = 132/346 (38%), Positives = 195/346 (56%), Gaps = 9/346 (2%) Query: 13 IAPYIAGK-PISEVAREFGLDEATIVKLASNENPLGMPESAQRAMAQAASELGRYPDANA 71 IAPY GK P++E R+ + KL++NE P G A A AA L YP+ + Sbjct: 13 IAPYTPGKSPVAEPGRK-------VFKLSANETPFGPSPHAIAAYKSAADHLEDYPEGTS 65 Query: 72 FELKAALSERYGVPADWVTLGNGSNDILEIAAHAFVEKGQSIVYAQYSFAVYALATQGLG 131 L+ A+ + YG+ D + G GS++IL + AH ++ G + +Q+ F VY +AT G Sbjct: 66 RILREAIGKAYGLDPDRIICGAGSDEILNLLAHTYLAPGDEAISSQHGFLVYPIATLANG 125 Query: 132 ARAIVVPAVKYGHDLDAMLAAVSDDTRLIFVANPNNPTGTFIEGPKLEAFLDKVPRHVVV 191 A+ +V P D+DAMLAAV+ +T+L+++ANPNNPTGT+I +++ +P HVV+ Sbjct: 126 AKNVVAPEKNLTTDVDAMLAAVTPNTKLVWLANPNNPTGTYIPFDEVKRLRAGLPSHVVL 185 Query: 192 VLDEAYTEYLPQEKRYDSIAWVRRYPNLLVSRTFSKAFGLAGLRVGFAIAQPELTDLLNR 251 VLD AY +Y+ + I V N +++ TFSK GLA LR+G+ + D +NR Sbjct: 186 VLDAAYADYVMKNDYELGIELVSTTENTVLTHTFSKVHGLAALRIGWMFGPANIVDAVNR 245 Query: 252 VRQPFNVNTLAQAAAIAALNDKAFLEKSAALNAQGYRRLTEAFDKLGLEYVPSDGNFVLV 311 +R PFNV+ AQ AA+AA+ D +E+S A + L E KLGL S NFVL+ Sbjct: 246 IRGPFNVSVPAQLAAVAAIQDTGHVERSRAHTDKWRNTLAEELPKLGLTVTRSVCNFVLI 305 Query: 312 RVGNDDA-AGNRVNLELLKQGVIVRPVGNYGLPQWLRITIGLPEEN 356 + L ++G+++R + NYGLP LR+TIG E N Sbjct: 306 HFPTTKGKTAAEADAFLTQRGLVLRALNNYGLPHALRMTIGTDEAN 351 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 365 Length adjustment: 30 Effective length of query: 340 Effective length of database: 335 Effective search space: 113900 Effective search space used: 113900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory