Align Cyclohexadienyl dehydrogenase and ADH prephenate dehydrogenase (characterized, see rationale)
to candidate WP_011159974.1 TX73_RS22680 prephenate dehydrogenase/arogenate dehydrogenase family protein
Query= uniprot:Q92MG1 (307 letters) >NCBI__GCF_000195775.1:WP_011159974.1 Length = 313 Score = 398 bits (1023), Expect = e-116 Identities = 198/300 (66%), Positives = 232/300 (77%) Query: 2 AQQFQTIALIGIGLIGSSIARDIREKQLAGTIVVTTRSEATLKRAGELGLGDRYTLSAAE 61 A F+ +ALIG GLIG SIAR + LAG IV T RSE+T R ELG+ D S AE Sbjct: 4 APMFRKVALIGFGLIGGSIARGAKSLGLAGEIVTTARSESTRARVRELGIVDHVVESNAE 63 Query: 62 AVEGADLVVVSVPVGASGAVAAEIAAHLKPGAIVTDVGSTKGSVIAQMAPHLPKDVHFVP 121 A +GADLV++ +PVGA G VA EIA HLK GAIV+DVGS KG+V+ MAP+LP+D+HFVP Sbjct: 64 AADGADLVILCIPVGACGDVAQEIAPHLKHGAIVSDVGSVKGAVVKAMAPYLPEDIHFVP 123 Query: 122 GHPIAGTEHSGPDAGFAGLFRGRWCILTPPAGTDEEAVARLRLFWETLGSMVDEMDPKHH 181 HP+AGTE+SGPD+GFA LF RWCILTPP GT+ EA +L FW LG+ V+ M P+HH Sbjct: 124 AHPVAGTENSGPDSGFAELFINRWCILTPPEGTNAEATEKLAAFWRALGANVEIMTPEHH 183 Query: 182 DKVLAIVSHLPHIIAYNIVGTADDLETVTESEVIKYSASGFRDFTRLAASDPTMWRDVCL 241 D VLA+ SHLPH+IAY IV TA++LE VT+SEV+K+SA GFRDFTR+AASDPTMWRDV L Sbjct: 184 DLVLAVTSHLPHLIAYTIVSTAEELEGVTQSEVLKFSAGGFRDFTRIAASDPTMWRDVFL 243 Query: 242 HNKDAILEMLARFSEDLASLQRAIRWGDGDKLFDLFTRTRAIRRSIVQAGQDTAMPDFGR 301 NKDA+LEML F EDL+ L RAIR GDGD LF+ FTRTRAIRR IVQ GQD A PDFGR Sbjct: 244 TNKDAVLEMLGEFQEDLSKLTRAIRRGDGDALFEHFTRTRAIRRGIVQIGQDEAAPDFGR 303 Lambda K H 0.320 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 313 Length adjustment: 27 Effective length of query: 280 Effective length of database: 286 Effective search space: 80080 Effective search space used: 80080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory