Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_011160305.1 TX73_RS24410 acetylornithine transaminase
Query= reanno::WCS417:GFF4238 (406 letters) >NCBI__GCF_000195775.1:WP_011160305.1 Length = 403 Score = 340 bits (871), Expect = 6e-98 Identities = 182/388 (46%), Positives = 245/388 (63%), Gaps = 5/388 (1%) Query: 17 MVPNYAPAAFIPVRGEGSRVWDQAGRELIDFAGGIAVNVLGHAHPALVGALTEQAHKLWH 76 ++P +A A RGEG + G +DF G+AVN LGH HP LV AL +QA KLWH Sbjct: 10 LLPVFARADVAFERGEGVWLHGTDGERYLDFTSGVAVNALGHCHPHLVEALQQQASKLWH 69 Query: 77 VSNVFTNEPALRLAHKLIDATFAERVFFCNSGAEANEAAFKLARRVAFDRFGSEKYEIIA 136 VSN+F + RLA +L + +FA++VFFCNSGAEA E A K+AR F + E+ +I Sbjct: 70 VSNLFKSPEGERLAARLCEQSFADKVFFCNSGAEAVECALKMARHYHFSKGEPERTRVIT 129 Query: 137 ALNSFHGRTLFTVNVGGQSKYSDGFGPKITGITHVPYNDLDALKAAVSDKTCAVVLEPIQ 196 +FHGRTL T+ G +KY +G+G + G +P DLDA+KAA+ T A+++EP+Q Sbjct: 130 FEGAFHGRTLGTLAATGSAKYLEGYGQPLEGFDQLPLGDLDAVKAAIGPNTAAILIEPLQ 189 Query: 197 GEGGVLPAELAYLQGARDLCDANNALLVFDEVQTGMGRSGHLFAYQHYGVTPDILTSAKS 256 GEGGV ELA+ +G R+LCDA+ LLVFDEVQTGMGR+G LFAY+ GV PDI+ AK+ Sbjct: 190 GEGGVRSPELAFFRGLRELCDAHGLLLVFDEVQTGMGRTGELFAYKRIGVAPDIMALAKA 249 Query: 257 LGGGFPIAAMLTTEALAKHLVVGTHGTTYGGNPLACAVAEAVIDVINTPEVLAGVNAKHD 316 LGGGFPI A L+T AK + G HG+T+GGNPLA AVA AV+DV+ P V Sbjct: 250 LGGGFPIGACLSTAEAAKGMAPGAHGSTFGGNPLAVAVANAVLDVMLQPGFFDHVKKMSL 309 Query: 317 LFKARLEQIGKQY-GIFTEVRGMGLLLGCVLSDAFKGKAKDVFNAAEKENLMILQAGPDV 375 L K +L + ++ + +E+RG GLLLG + ++ A E L+ + AG +V Sbjct: 310 LLKQKLAGVVDRHPRVVSEIRGEGLLLGL----KAVVPSPELIAALRAEKLLSVGAGDNV 365 Query: 376 VRFAPSLVVEDADIKEGLDRFERAVKAL 403 VR P L+V +A++ E + R ERA L Sbjct: 366 VRLLPPLIVNEAELDEAVGRLERACVTL 393 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 472 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 403 Length adjustment: 31 Effective length of query: 375 Effective length of database: 372 Effective search space: 139500 Effective search space used: 139500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory