Align Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 (characterized)
to candidate WP_011187682.1 DP_RS02175 ornithine carbamoyltransferase
Query= SwissProt::P11724 (305 letters) >NCBI__GCF_000025945.1:WP_011187682.1 Length = 303 Score = 316 bits (810), Expect = 4e-91 Identities = 152/296 (51%), Positives = 213/296 (71%), Gaps = 4/296 (1%) Query: 5 HFLSFMDYSPEELIGLIRRGSELKDLRNRGVLYEPLKSRVLGMVFEKASTRTRLSFEAGM 64 H S D++ EE+ LI R ELK+ R+RG+ ++ L + + ++FEK STRTR+SFE+ M Sbjct: 4 HLSSLGDFTGEEIASLIARAIELKEERSRGIRHQQLAGKSVALIFEKPSTRTRVSFESAM 63 Query: 65 IQLGGQAIFLSPRDTQLGRGEPIGDSARVMSRMLDGVMIRTFAHATLTEFAAHSKVPVIN 124 LGGQ +FLS RDTQL R EP+ D ARVMSR +DG+++RTF + E A ++ VPVIN Sbjct: 64 YGLGGQVLFLSGRDTQLSRSEPLKDMARVMSRYVDGIVVRTFGQEVVNELAQYATVPVIN 123 Query: 125 GLSDDLHPCQLLADMQTFHEHRGSIQGKTVAWIGDGNNMCNSYIEAALKFDFQLRVACPE 184 L+D HPCQ+L+D+ T E +G+IQ + W+GDGNNM NS+I+AA K F+L +ACPE Sbjct: 124 ALTDLHHPCQILSDIMTVIEKKGAIQDLKIVWVGDGNNMANSWIQAAAKLGFELILACPE 183 Query: 185 GYEPKAEFVALA----GDRLRVVRDPREAVAGAHLVSTDVWASMGQEDEAAARIALFRPY 240 GY+P AE +A A + ++RDP+ AV GA +++ DV+ASMGQE E R+ +F Y Sbjct: 184 GYDPDAEILAAAQAEGAKPITLLRDPQTAVLGADVINVDVFASMGQESEQDERLKIFASY 243 Query: 241 QVNAALLDGAADDVLFMHCLPAHRGEEISEELLDDPRSVAWDQAENRLHAQKALLE 296 QVNA ++ AADD + +HCLPAHRGEEI+E++L+ P+ VA+D+AEN++H KA+LE Sbjct: 244 QVNAEMMAKAADDAIVLHCLPAHRGEEITEDVLEGPQCVAFDEAENKMHMHKAILE 299 Lambda K H 0.322 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 303 Length adjustment: 27 Effective length of query: 278 Effective length of database: 276 Effective search space: 76728 Effective search space used: 76728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate WP_011187682.1 DP_RS02175 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.8180.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-125 403.7 0.0 2.8e-125 403.5 0.0 1.0 1 lcl|NCBI__GCF_000025945.1:WP_011187682.1 DP_RS02175 ornithine carbamoyltr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025945.1:WP_011187682.1 DP_RS02175 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 403.5 0.0 2.8e-125 2.8e-125 2 303 .. 4 302 .. 3 303 .] 0.98 Alignments for each domain: == domain 1 score: 403.5 bits; conditional E-value: 2.8e-125 TIGR00658 2 hllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvly 70 hl sl d++ ee+ +l+ +a +lk+e+ +g ++++l gk++aliFek+stRtRvsfe a+y lG+qvl+ lcl|NCBI__GCF_000025945.1:WP_011187682.1 4 HLSSLGDFTGEEIASLIARAIELKEERSRGIRHQQLAGKSVALIFEKPSTRTRVSFESAMYGLGGQVLF 72 8899***************************************************************** PP TIGR00658 71 lnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDllti 139 l+ ++ql+r e++kD arv+sryvd+ivvR++ +e v+ela+ya+vPvin+Ltdl hPcqil+D++t+ lcl|NCBI__GCF_000025945.1:WP_011187682.1 73 LSGRDTQLSRSEPLKDMARVMSRYVDGIVVRTFGQEVVNELAQYATVPVINALTDLHHPCQILSDIMTV 141 ********************************************************************* PP TIGR00658 140 keklgklkevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggklelte 208 +ek+g+++++k+v+vGD+nn+ans + aaaklG+++ +a+Peg++p+aei+ a++ e ++l++ lcl|NCBI__GCF_000025945.1:WP_011187682.1 142 IEKKGAIQDLKIVWVGDGNNMANSWIQAAAKLGFELILACPEGYDPDAEILAAAQA---EGAKPITLLR 207 ***************************************************99965...44456***** PP TIGR00658 209 dpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdevl 277 dp+ av +advi Dv++smG+e++++erlk++ yqvn e+++ a +++++lhCLPa+rGee+t++vl lcl|NCBI__GCF_000025945.1:WP_011187682.1 208 DPQTAVLGADVINVDVFASMGQESEQDERLKIFASYQVNAEMMAKAADDAIVLHCLPAHRGEEITEDVL 276 ********************************************************************* PP TIGR00658 278 egeasivfdeaenRlhaqkavlkall 303 eg++ + fdeaen++h ka+l+ +l lcl|NCBI__GCF_000025945.1:WP_011187682.1 277 EGPQCVAFDEAENKMHMHKAILERFL 302 **********************9877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (303 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.43 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory