Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_011187862.1 DP_RS03070 aspartate/tyrosine/aromatic aminotransferase
Query= BRENDA::A0A140ND68 (396 letters) >NCBI__GCF_000025945.1:WP_011187862.1 Length = 398 Score = 410 bits (1055), Expect = e-119 Identities = 202/396 (51%), Positives = 260/396 (65%) Query: 1 MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENE 60 M++NI AAPAD ILGL + FR D P K+NLG+G+YKDE G TP+L VK AE L+E E Sbjct: 1 MWQNIEAAPADSILGLTEAFRNDPNPAKVNLGVGIYKDEQGATPILQCVKNAEARLIETE 60 Query: 61 TTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSV 120 +K YL I G P + Q+LLFG+ S +I+ KRA TA PGGTGALR+ A L Sbjct: 61 ESKVYLPISGAPAYTENVQKLLFGEESEVISSKRAITAHAPGGTGALRMGAGLLKTFFPE 120 Query: 121 KRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGC 180 +VWVS P+W NH +F+S G E+ Y YYD + ++DF A++ SL GD+VL H C Sbjct: 121 AKVWVSTPTWANHTGIFSSTGFEIAHYPYYDETHRSVDFQAMLMSLRAVPEGDIVLLHAC 180 Query: 181 CHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIV 240 CHNPTG+D TLEQW + ++ E+ W+P DFAYQGF G ED + A + V Sbjct: 181 CHNPTGVDLTLEQWHQVVAIAQERNWIPFLDFAYQGFGVGTSEDRCAIELCAEAGIDFFV 240 Query: 241 ASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSN 300 ASS+SKNFG+YNER GA T+VAA+ + A S +K IR YSNPPAHG V ATILS+ Sbjct: 241 ASSFSKNFGMYNERTGAITVVAANQASAAVALSHLKKTIRVVYSNPPAHGGLVAATILSD 300 Query: 301 DALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLR 360 L +W+QEL DMR+RI MR V L +G ++DFSFI +Q+GMFSFSGL+ E V Sbjct: 301 PELYDLWQQELQDMRERIIAMRVALVEGLSSRGVDQDFSFITEQSGMFSFSGLSDEIVAW 360 Query: 361 LREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 396 LR+E +Y V GR+N+AG+T N+ +C+AI L Sbjct: 361 LRKEKSIYVVGGGRINLAGLTASNIDYVCDAIAEAL 396 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 473 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 398 Length adjustment: 31 Effective length of query: 365 Effective length of database: 367 Effective search space: 133955 Effective search space used: 133955 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory