Align Aromatic-amino-acid transaminase (EC 2.6.1.57) (characterized)
to candidate WP_011187887.1 DP_RS03205 histidinol-phosphate aminotransferase
Query= reanno::BFirm:BPHYT_RS14905 (370 letters) >NCBI__GCF_000025945.1:WP_011187887.1 Length = 379 Score = 271 bits (693), Expect = 2e-77 Identities = 147/365 (40%), Positives = 221/365 (60%), Gaps = 10/365 (2%) Query: 7 PSYVRAIAPYIAGKPISEVAREFGLDEATIVKLASNENPLGMPESAQRAMAQAASELGRY 66 P + I PY GKP+ E+ RE+G+ ++ +KLASNENP G A +A+ ++ ++ RY Sbjct: 15 PENIENIKPYPPGKPLDELEREYGITDS--IKLASNENPWGASPKAIKAIGESLGDMQRY 72 Query: 67 PDANAFELKAALSERYGVPADWVTLGNGSNDILEIAAHAFVEKGQSIVYAQYSFAVYALA 126 PD +A+ L A+++ GV + LGNGSN+++E AFV+ ++ + SF +Y Sbjct: 73 PDGSAYYLTEAIAKYAGVGMSEIILGNGSNEVIEFLVKAFVQDDSEVITSHPSFLMYQKF 132 Query: 127 TQGLGARAIVVPAVKYGHDLDAMLAAVSDDTRLIFVANPNNPTGTFIEGPKLEAFLDKVP 186 Q G V+P HDL +L V++ TRLIF+ NPNNPTGT++E L F++ +P Sbjct: 133 VQVRGGVNRVIPLKDMHHDLQTILDTVNEKTRLIFIDNPNNPTGTYLEPELLIDFINSLP 192 Query: 187 RHVVVVLDEAYTEYLPQEKRYDSIAWVRRYP---NLLVSRTFSKAFGLAGLRVGFAIAQP 243 HV++VLDEAY +++ +K D + ++ ++ RTFSKA+GL+GLRVGF + Sbjct: 193 EHVILVLDEAYVDFMDLDKWLDVPSLIKNQAGRCGIVSLRTFSKAYGLSGLRVGFGLMAE 252 Query: 244 ELTDLLNRVRQPFNVNTLAQAAAIAALNDKAFLEKSAALNAQGYRRLTEAFDKLGLEYVP 303 E+ L++VRQPFNVN+LAQ A+AAL D F E++ N QG + L + LG E Sbjct: 253 EIVTCLHKVRQPFNVNSLAQVGALAALGDVDFYEQTLLKNRQGMKWLMKEIKGLGCEPFA 312 Query: 304 SDGNFVLVRV-GNDDAAGNRVNLELLKQGVIVRPVGNYGLPQWLRITIGLPEENEAFIAA 362 S NF L+ V GN D ++ E+L +GVI+R + YG P ++R+T+G EN+ F+ A Sbjct: 313 SQTNFFLIDVQGNAD----KLYTEMLYKGVIIRSMSAYGYPHYIRVTVGTTVENKRFLKA 368 Query: 363 LERTL 367 L L Sbjct: 369 LSDCL 373 Lambda K H 0.318 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 379 Length adjustment: 30 Effective length of query: 340 Effective length of database: 349 Effective search space: 118660 Effective search space used: 118660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory