Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate WP_011188481.1 DP_RS06260 cysteine synthase A
Query= BRENDA::P9WP55 (310 letters) >NCBI__GCF_000025945.1:WP_011188481.1 Length = 306 Score = 343 bits (880), Expect = 3e-99 Identities = 179/300 (59%), Positives = 218/300 (72%) Query: 7 ITQLIGRTPLVRLRRVTDGAVADIVAKLEFFNPANSVKDRIGVAMLQAAEQAGLIKPDTI 66 I Q IG TPL++L R+ A I+ K E NPA SVK R+ V+M++ + G I T Sbjct: 5 IGQSIGNTPLLKLGRLDRDCAATILVKQESRNPAGSVKCRVAVSMIETGLREGKISKGTT 64 Query: 67 ILEPTSGNTGIALAMVCAARGYRCVLTMPETMSLERRMLLRAYGAELILTPGADGMSGAI 126 I+EPTSGNTGI LA VCAA+G R +LTMPE+MS+ERR LL GAE++LTP A+GM+GAI Sbjct: 65 IVEPTSGNTGIGLAFVCAAKGLRLILTMPESMSIERRKLLAHLGAEIVLTPAAEGMTGAI 124 Query: 127 AKAEELAKTDQRYFVPQQFENPANPAIHRVTTAEEVWRDTDGKVDIVVAGVGTGGTITGV 186 KAEEL F+P QF NPANP IHR TT +E+ RDTDG+VDI VAGVGTGGT+TGV Sbjct: 125 TKAEELLTGLADGFMPDQFNNPANPEIHRQTTGKEILRDTDGRVDIFVAGVGTGGTLTGV 184 Query: 187 AQVIKERKPSARFVAVEPAASPVLSGGQKGPHPIQGIGAGFVPPVLDQDLVDEIITVGNE 246 V+K + P + +AVEPA S V+SG GPH IQGIGAGF+P LD L+DE I V +E Sbjct: 185 GSVLKAKNPRVQVIAVEPATSAVISGEAPGPHGIQGIGAGFIPGNLDISLIDETIKVNDE 244 Query: 247 DALNVARRLAREEGLLVGISSGAATVAALQVARRPENAGKLIVVVLPDFGERYLSTPLFA 306 DAL A+ LA +EG+L GISSGAA A+L+VA+RPEN GK IV +LPD GERYLST LF+ Sbjct: 245 DALVAAQELATQEGILCGISSGAAFWASLEVAKRPENIGKTIVTILPDTGERYLSTNLFS 304 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 306 Length adjustment: 27 Effective length of query: 283 Effective length of database: 279 Effective search space: 78957 Effective search space used: 78957 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_011188481.1 DP_RS06260 (cysteine synthase A)
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.7249.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-137 441.8 0.6 6.6e-137 441.6 0.6 1.0 1 lcl|NCBI__GCF_000025945.1:WP_011188481.1 DP_RS06260 cysteine synthase A Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025945.1:WP_011188481.1 DP_RS06260 cysteine synthase A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 441.6 0.6 6.6e-137 6.6e-137 3 298 .] 7 303 .. 5 303 .. 0.99 Alignments for each domain: == domain 1 score: 441.6 bits; conditional E-value: 6.6e-137 TIGR01139 3 eliGntPlvrLn.laeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGntGi 70 + iGntPl++L l +++a +lvk es+nP++svk+r+a++mie +eg++ kg+tive+tsGntGi lcl|NCBI__GCF_000025945.1:WP_011188481.1 7 QSIGNTPLLKLGrLDRDCAATILVKQESRNPAGSVKCRVAVSMIETGLREGKISKGTTIVEPTSGNTGI 75 78*********98999***************************************************** PP TIGR01139 71 alamvaaargykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllkqf 139 +la+v+aa+g++liltmpe+ms+errkll +Gae+vLt++aegm+gai+kaeel++ ++ + ++ qf lcl|NCBI__GCF_000025945.1:WP_011188481.1 76 GLAFVCAAKGLRLILTMPESMSIERRKLLAHLGAEIVLTPAAEGMTGAITKAEELLTGLADGF-MPDQF 143 ************************************************************999.***** PP TIGR01139 140 enpanpeihrkttapeilkdldgkldafvagvGtGGtitGvgevlkekkpdikvvavePaespvlsggk 208 +npanpeihr+tt++eil+d+dg++d+fvagvGtGGt+tGvg+vlk k+p ++v+avePa+s+v+sg+ lcl|NCBI__GCF_000025945.1:WP_011188481.1 144 NNPANPEIHRQTTGKEILRDTDGRVDIFVAGVGTGGTLTGVGSVLKAKNPRVQVIAVEPATSAVISGEA 212 ********************************************************************* PP TIGR01139 209 pgphkiqGigagfiPkvLdkevidevikvsdeeaietarrlakeeGilvGissGaavaaalkvakkle. 276 pgph iqGigagfiP +Ld ++ide ikv+de+a+ a++la++eGil GissGaa +a+l+vak++e lcl|NCBI__GCF_000025945.1:WP_011188481.1 213 PGPHGIQGIGAGFIPGNLDISLIDETIKVNDEDALVAAQELATQEGILCGISSGAAFWASLEVAKRPEn 281 ********************************************************************9 PP TIGR01139 277 kdkkivvilpdtgerYlstaLf 298 +k+iv+ilpdtgerYlst+Lf lcl|NCBI__GCF_000025945.1:WP_011188481.1 282 IGKTIVTILPDTGERYLSTNLF 303 9********************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (306 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.97 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory