Align 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; L-2AA aminotransferase; EC 2.6.1.39 (characterized)
to candidate WP_011189789.1 DP_RS12955 adenosylmethionine--8-amino-7-oxononanoate transaminase
Query= SwissProt::Q88FI7 (416 letters) >NCBI__GCF_000025945.1:WP_011189789.1 Length = 435 Score = 135 bits (340), Expect = 2e-36 Identities = 119/393 (30%), Positives = 182/393 (46%), Gaps = 38/393 (9%) Query: 29 TDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPHGPYLALMEQLSQFV 88 TDG++ +D + G+ NP + A+ Q +R++H F H P + L + L Q V Sbjct: 45 TDGRQLVDGMSSWWAAIHGYNNPVLNRALVEQVSRVSHVMFGGLTHEPAVELGKILLQLV 104 Query: 89 PVSYPLAGMLTNSGAEAAENALKVAR------GATGKRAIIAFDGGFHGRTLATLNL--- 139 P S +SG+ A E A+K+A G K+ + GG+HG T +++ Sbjct: 105 PKSLNRI-FYCDSGSVAIEVAMKMAMQYMHALGQPQKKRFVTIRGGYHGDTFHGMSVCDP 163 Query: 140 -NGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQA-LKAMDRLFSVELAVEDVAAFIFE 197 NG Y G LP + P+ + + A M RL VE +++ A I E Sbjct: 164 VNGMHGLY---AGVLP-EYFFADRPTTSFFASWDAADFVGMRRL--VEENQQNICAIILE 217 Query: 198 P-VQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAFPRLGIEPDLLL 256 P VQG GG P + + +R CDE G+L+I DEI +GFGRTG+ FA GIEPD+L Sbjct: 218 PIVQGAGGMYFYHPQYLREVRALCDEYGLLLIADEIATGFGRTGKLFACEHAGIEPDILC 277 Query: 257 LAKSIAGG-MPLGAVVGRKELMAALPKGG-----LGGTYSGNPISCAAALASLAQMTDEN 310 L K+I GG M A + +E+ + G T+ GNP++C+ A ASL Q+ EN Sbjct: 278 LGKAITGGYMSFAATLATEEVGRVISSAAPGVFMHGPTFMGNPLACSVAKASL-QLLIEN 336 Query: 311 LATWGERQEQAIVSRYERWKASGLSPYIGR--LTGVGAMRGIEFANADGSPAPAQLAKVM 368 W Q V + GL+P + + V + GI + + ++ Sbjct: 337 --DW-----QTQVEGLAKGLEEGLAPCLDLDCVAEVRVLGGIGVVELHAPLSSQGMVQIQ 389 Query: 369 EAARARGLLLMPSGKARHIIRLLAPLTIEAEVL 401 A G+ + P G+ ++ L+ P + E L Sbjct: 390 AAFVEAGIWVRPFGR---LVYLMPPYIMSKEEL 419 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 486 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 435 Length adjustment: 32 Effective length of query: 384 Effective length of database: 403 Effective search space: 154752 Effective search space used: 154752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory