Align 3-isopropylmalate dehydratase small subunit; EC 4.2.1.33; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase (uncharacterized)
to candidate WP_011305283.1 MBAR_RS01380 3-isopropylmalate dehydratase small subunit
Query= curated2:O27440 (162 letters) >NCBI__GCF_000195895.1:WP_011305283.1 Length = 165 Score = 191 bits (485), Expect = 5e-54 Identities = 94/155 (60%), Positives = 117/155 (75%), Gaps = 4/155 (2%) Query: 3 GKVWKFPDDVDTDIIIPGRYLVMRDPEKLREHVMEGLDPEFPSKVKPGDFIVAGKNFGCG 62 G++WKF DD+DTD+IIPG+YL +D + H MEG+DPEF KVKPGD IVAG NFGCG Sbjct: 7 GRIWKFGDDIDTDVIIPGKYLRTKDMQVFAAHAMEGIDPEFAKKVKPGDVIVAGSNFGCG 66 Query: 63 SSREHAPLALKGAGIAAVIAESFARIFYRNAINVGIPLLEAPGITEKLNEGDEIEVDLDR 122 SSRE APLALK AGIA ++A+SFARIF+RNAINVG+PL+EA + EGDE+ VDL + Sbjct: 67 SSREQAPLALKHAGIACIVAKSFARIFFRNAINVGLPLIEA---DIECQEGDEVRVDLLK 123 Query: 123 G-VIIRGDDEFPFKKLPDFMVEILEKGGLIPYLKK 156 G V + G F KLPDF+++IL GGL+ + KK Sbjct: 124 GEVTVSGKGTFRGNKLPDFLLQILADGGLVTHRKK 158 Lambda K H 0.320 0.146 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 162 Length of database: 165 Length adjustment: 18 Effective length of query: 144 Effective length of database: 147 Effective search space: 21168 Effective search space used: 21168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
Align candidate WP_011305283.1 MBAR_RS01380 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR02087 (3-isopropylmalate dehydratase, small subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02087.hmm # target sequence database: /tmp/gapView.26045.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02087 [M=157] Accession: TIGR02087 Description: LEUD_arch: 3-isopropylmalate dehydratase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-78 248.2 0.1 1.6e-78 248.0 0.1 1.0 1 lcl|NCBI__GCF_000195895.1:WP_011305283.1 MBAR_RS01380 3-isopropylmalate d Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000195895.1:WP_011305283.1 MBAR_RS01380 3-isopropylmalate dehydratase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 248.0 0.1 1.6e-78 1.6e-78 1 156 [. 7 158 .. 7 159 .. 0.99 Alignments for each domain: == domain 1 score: 248.0 bits; conditional E-value: 1.6e-78 TIGR02087 1 GrvwkfGddvdtdaiiPgrylrttdlkelakhamegidpefakkvreGdvivaGknfGiGssreqaala 69 Gr+wkfGdd+dtd+iiPg+ylrt+d++ +a+hamegidpefakkv++GdvivaG nfG+Gssreqa+la lcl|NCBI__GCF_000195895.1:WP_011305283.1 7 GRIWKFGDDIDTDVIIPGKYLRTKDMQVFAAHAMEGIDPEFAKKVKPGDVIVAGSNFGCGSSREQAPLA 75 9******************************************************************** PP TIGR02087 70 lkaaGvaaviaesfarifyrnainvGlplivaedvtelikdGdevevdlekgeirkvakkevlkleele 138 lk+aG+a+++a+sfarif+rnainvGlpli+a+ +e++ +Gdev+vdl kge+ v++k +++ ++l+ lcl|NCBI__GCF_000195895.1:WP_011305283.1 76 LKHAGIACIVAKSFARIFFRNAINVGLPLIEAD--IECQ-EGDEVRVDLLKGEVT-VSGKGTFRGNKLP 140 ******************************999..8999.6**************.9************ PP TIGR02087 139 dllleileeGGlleylkk 156 d+ll+il++GGl+ ++kk lcl|NCBI__GCF_000195895.1:WP_011305283.1 141 DFLLQILADGGLVTHRKK 158 ***************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (157 nodes) Target sequences: 1 (165 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 4.28 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory