Align Pyrroline-5-carboxylate reductase; P5C reductase; P5CR; PCA reductase; EC 1.5.1.2 (characterized)
to candidate WP_011305514.1 MBAR_RS02615 pyrroline-5-carboxylate reductase
Query= SwissProt::Q9HH99 (270 letters) >NCBI__GCF_000195895.1:WP_011305514.1 Length = 272 Score = 455 bits (1171), Expect = e-133 Identities = 234/269 (86%), Positives = 255/269 (94%) Query: 2 ENQKIGFIGAGKMGSALMQGTIKAGIVTPENIGASDVYEPFLKDLQAKLGIRVSTDNAVI 61 +NQKIGFIGAGKMGSALMQG IKAGIV PEN+GA+DVYEPFL DL+AKLGI +STDN+VI Sbjct: 4 QNQKIGFIGAGKMGSALMQGIIKAGIVKPENLGAADVYEPFLNDLKAKLGINISTDNSVI 63 Query: 62 VRESDILILAVKPQTLSSVLSNLKNEITSEKLVISIAAGVPLSTYEDALLEGTRVVRVMP 121 R SDIL+LAVKPQTL SVL NLK +ITS+KL+ISIAAGVPL+TYE+AL GTRV+RVMP Sbjct: 64 ARASDILLLAVKPQTLGSVLENLKADITSDKLIISIAAGVPLATYENALPAGTRVIRVMP 123 Query: 122 NIAATVSEAASGIAPGKNATPEDLKAALEIFSAVGTAVQVPESLMDAVTGLSGSGPAFIF 181 NIAATVSEAASGIAPGKNATPED+K ALEIFSAVGTAVQV ES+MDAVTGLSGSGPAFIF Sbjct: 124 NIAATVSEAASGIAPGKNATPEDVKTALEIFSAVGTAVQVSESIMDAVTGLSGSGPAFIF 183 Query: 182 PVIEAMADGAVLEGMDRKSALTLAAQTVLGAAKMALETGMHPGELKDMVTSPAGTTIQGI 241 PVIEAMADGAVLEGMDRKSALTL+AQTVLGAAKM LETG+HPGELKDMVTSPAGTTIQG+ Sbjct: 184 PVIEAMADGAVLEGMDRKSALTLSAQTVLGAAKMMLETGLHPGELKDMVTSPAGTTIQGV 243 Query: 242 HSLEEAGIRAAFMNAVIRASERSKELGKK 270 H+LEEAG+RAAFMNAVIRA+ERSKELGKK Sbjct: 244 HALEEAGVRAAFMNAVIRATERSKELGKK 272 Lambda K H 0.313 0.130 0.343 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 357 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 270 Length of database: 272 Length adjustment: 25 Effective length of query: 245 Effective length of database: 247 Effective search space: 60515 Effective search space used: 60515 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
Align candidate WP_011305514.1 MBAR_RS02615 (pyrroline-5-carboxylate reductase)
to HMM TIGR00112 (proC: pyrroline-5-carboxylate reductase (EC 1.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00112.hmm # target sequence database: /tmp/gapView.24448.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00112 [M=263] Accession: TIGR00112 Description: proC: pyrroline-5-carboxylate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-89 284.5 8.3 5.2e-89 284.3 8.3 1.0 1 lcl|NCBI__GCF_000195895.1:WP_011305514.1 MBAR_RS02615 pyrroline-5-carboxy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000195895.1:WP_011305514.1 MBAR_RS02615 pyrroline-5-carboxylate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 284.3 8.3 5.2e-89 5.2e-89 1 263 [] 8 269 .. 8 269 .. 0.99 Alignments for each domain: == domain 1 score: 284.3 bits; conditional E-value: 5.2e-89 TIGR00112 1 iaiiGaGnmgeallsgllkkgakakkeilvierseeklaalakelgvevtsdaeeavkeadvvllavKP 69 i++iGaG+mg+al++g++k+g +++++ ++ e+ l++l ++lg++ ++d+ +++++d++llavKP lcl|NCBI__GCF_000195895.1:WP_011305514.1 8 IGFIGAGKMGSALMQGIIKAGIVKPENLGAADVYEPFLNDLKAKLGINISTDNSVIARASDILLLAVKP 76 89*****************************999*********************************** PP TIGR00112 70 qdleevlaelkseektkeklliSilAGvtiekleqlleaekrvvRvmPNtaakvgagvtaiaassevse 138 q l +vl++lk + t +kl+iSi+AGv+++++e++l+a +rv+RvmPN+aa+v +++++ia ++++++ lcl|NCBI__GCF_000195895.1:WP_011305514.1 77 QTLGSVLENLKA-DITSDKLIISIAAGVPLATYENALPAGTRVIRVMPNIAATVSEAASGIAPGKNATP 144 ***********8.999***************************************************** PP TIGR00112 139 eqkelveellkavGkvveveeklldavtalsGSgPAfvflliealadagvklGLpreeakelaaqtlkG 207 e+ +++ e+++avG++v+v+e+ +davt+lsGSgPAf+f +iea+ad++v +G++r+ a++l+aqt+ G lcl|NCBI__GCF_000195895.1:WP_011305514.1 145 EDVKTALEIFSAVGTAVQVSESIMDAVTGLSGSGPAFIFPVIEAMADGAVLEGMDRKSALTLSAQTVLG 213 ********************************************************************* PP TIGR00112 208 aaklleesgehpalLkdkVtsPgGtTiaglavLeekgvrsavieaveaavkrseeL 263 aak++ e+g hp +Lkd VtsP+GtTi+g+++Lee+gvr+a+++av +a++rs+eL lcl|NCBI__GCF_000195895.1:WP_011305514.1 214 AAKMMLETGLHPGELKDMVTSPAGTTIQGVHALEEAGVRAAFMNAVIRATERSKEL 269 ******************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (263 nodes) Target sequences: 1 (272 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.00 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory