Align Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 (characterized)
to candidate WP_011305945.1 MBAR_RS04980 shikimate dehydrogenase
Query= SwissProt::Q58484 (282 letters) >NCBI__GCF_000195895.1:WP_011305945.1 Length = 280 Score = 235 bits (599), Expect = 9e-67 Identities = 133/278 (47%), Positives = 180/278 (64%), Gaps = 6/278 (2%) Query: 7 KVIGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLPENLKYVIDGAKALGIVGFNVT 66 +V G+ G P+ HS SP MHNAAF G++ +Y AF V PE L+ I GA+A+G G N+T Sbjct: 3 QVFGVFGDPIAHSLSPAMHNAAFSALGMDCIYHAFRVKPEKLEKAILGAEAMGFGGLNLT 62 Query: 67 IPHKIEIMKYLDEIDKD--AQLIGAVNTIKI-EDGKAIGYNTDGIGARMALEEEIGRVKD 123 +P K +K LD I D A+ IGAVNTI E G+ GYNTDG+GA+ AL+ ++ Sbjct: 63 VPLKETALK-LDCIKPDPLAEKIGAVNTIVFGETGEIKGYNTDGLGAKQALQNSAVEMEG 121 Query: 124 KNIVIYGAGGAARAVAFELAKDN-NIIIANRTVEKAEALAKEIAEKLNKKFGEEVKFSGL 182 IV+ GAGGAAR++AF+LA D I I NRT +A LAK+I+ SGL Sbjct: 122 SKIVVTGAGGAARSIAFQLAADGAEITIVNRTEGRAIELAKDISAASLSGNVTGKGLSGL 181 Query: 183 DVDLDGVDIIINATPIGMYPNIDVEPIVKAEKLREDMVVMDLIYNPLETVLLKEAKKVNA 242 L +I+IN T +GM+PN+D I AE L D+ V D++YNPLET LL+EAK A Sbjct: 182 KNLLQDANILINTTTLGMHPNVDTA-IATAEDLHPDLTVFDIVYNPLETRLLREAKASGA 240 Query: 243 KTINGLGMLIYQGAVAFKIWTGVEPNIEVMKNAIIDKI 280 KT++G+ ML+YQGA AFK+WTG+EP +E+MK +++ + Sbjct: 241 KTVSGVLMLVYQGAEAFKLWTGIEPPVELMKKTVLEAL 278 Lambda K H 0.318 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 280 Length adjustment: 26 Effective length of query: 256 Effective length of database: 254 Effective search space: 65024 Effective search space used: 65024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate WP_011305945.1 MBAR_RS04980 (shikimate dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.25866.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-85 272.2 0.2 2.3e-85 272.0 0.2 1.0 1 lcl|NCBI__GCF_000195895.1:WP_011305945.1 MBAR_RS04980 shikimate dehydroge Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000195895.1:WP_011305945.1 MBAR_RS04980 shikimate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 272.0 0.2 2.3e-85 2.3e-85 2 269 .. 4 278 .. 3 279 .. 0.93 Alignments for each domain: == domain 1 score: 272.0 bits; conditional E-value: 2.3e-85 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlel 70 ++gv+G+pi+hS+sp++hnaa++ lg+++ Y+af v++e+leka+ g+ a g+ G+n+TvP+Ke +l+l lcl|NCBI__GCF_000195895.1:WP_011305945.1 4 VFGVFGDPIAHSLSPAMHNAAFSALGMDCIYHAFRVKPEKLEKAILGAEAMGFGGLNLTVPLKETALKL 72 79*****************************************************************96 PP TIGR00507 71 .lDeieesakligavNTlk.ledgklvgynTDgiGlvssLek.lsklksekrvliiGAGGaakavaleL 136 + + ++ a++igavNT++ e g++ gynTDg+G++++L++ +++ + ++++ GAGGaa+++a++L lcl|NCBI__GCF_000195895.1:WP_011305945.1 73 dCIKPDPLAEKIGAVNTIVfGETGEIKGYNTDGLGAKQALQNsAVEME-GSKIVVTGAGGAARSIAFQL 140 44466778***********8899*******************666666.9******************* PP TIGR00507 137 lkadkeviiaNRtvekaeelaerlqe...lgei..lalsleevelkkvdliinatsaglsgeideaevk 200 + + e++i+NRt+ +a ela+ + + g++ + ls + l+ +++in+t +g+++++d a+ + lcl|NCBI__GCF_000195895.1:WP_011305945.1 141 AADGAEITIVNRTEGRAIELAKDISAaslSGNVtgKGLSGLKNLLQDANILINTTTLGMHPNVDTAIAT 209 ************************99888555511556777777888****************99999* PP TIGR00507 201 aellkegklvvDlvynpletpllkeakkkgtkvidGlgMlvaQaalsFelwtgvepdvekvfealkekl 269 ae l+ + v+D+vynplet ll+eak g+k++ G+ Mlv+Q+a +F+lwtg+ep+ve +++++ e+l lcl|NCBI__GCF_000195895.1:WP_011305945.1 210 AEDLHPDLTVFDIVYNPLETRLLREAKASGAKTVSGVLMLVYQGAEAFKLWTGIEPPVELMKKTVLEAL 278 ****************************************************************99987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (280 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.28 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory