Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate WP_011307353.1 MBAR_RS12680 aspartate aminotransferase family protein
Query= curated2:Q58131 (398 letters) >NCBI__GCF_000195895.1:WP_011307353.1 Length = 471 Score = 248 bits (633), Expect = 3e-70 Identities = 155/396 (39%), Positives = 223/396 (56%), Gaps = 42/396 (10%) Query: 22 PVVLVEGKGMEVYDIDGKKYLDFLAGIGVNNVGHCHPKVVEAIKKQAETLIHTS-NIYYT 80 P+V+ KG + D+DG++Y+D +AGI V N G+ +P+V AI Q E + H ++ Sbjct: 71 PLVVDSAKGSVIRDVDGREYIDLIAGIAVMNAGYSNPEVKAAISAQLEKMTHCGYGDFFA 130 Query: 81 IPQIKLAKKLVELSGLDRAFFCNSGAEANEGAIKFARKYVSKVLGREGGEIISMYNAFHG 140 P +KLAKKL +LSG + F+CNSG EA E AIK A R+G +IS YN+FHG Sbjct: 131 EPPVKLAKKLEDLSGYSKVFYCNSGTEAVEAAIKLAFWKTK----RQG--LISFYNSFHG 184 Query: 141 RTLTTLAATPKPKYQDGFYPL--------------PPGFKYVPFNDIEALKE-------- 178 RTL +L+ T Q +P+ P +Y P IE KE Sbjct: 185 RTLGSLSLTCSKARQKEHFPVLHTAHSHYAYCYRCPFKLEY-PSCGIECAKELENLIFRR 243 Query: 179 --AITDKTAAIMIEPVQGEGGIHVADKDYLKAVRDLCDDKNIVLIFDEVQCGMGRTGRMF 236 + TD TAA+ +EPVQGEGG V ++ K VR +C D +++L+ DEVQ G RTG Sbjct: 244 ELSPTD-TAAVFVEPVQGEGGYIVPPPEFHKEVRRICTDNDVLLVADEVQAGCFRTGPFL 302 Query: 237 AFEHYGVEPDILTLAKALGGGVPIGAVVLKEEIAKALSYGDHGTTFGGNPLACSAALASV 296 A E++GV +I AKALGGG+P+GA++ E+ G H TFGGN LA +A+LAS+ Sbjct: 303 AMENFGVRAEISCFAKALGGGLPLGAMLADRELMD-WPQGIHSNTFGGNLLASAASLASL 361 Query: 297 EVIEELIKDDKVIEKGKYFIRKLENLIEKYNFIKEVRGLGLMIGAEL--------EFNGA 348 E +E+ + +V E G ++L L E + I +VRGLGLM+G E+ Sbjct: 362 EFLEKENIEHRVKELGSQMKQRLRELQENFPCIGDVRGLGLMVGVEIVKPDKSIDPIQRD 421 Query: 349 DIVKKMLEKGFLINCTSDTVLRFLPPLIVEKEHIDA 384 I++K ++G L+ D+V+RF PPL++ E +D+ Sbjct: 422 RILRKAFKEGILLLPCGDSVIRFSPPLVITDEELDS 457 Lambda K H 0.320 0.141 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 472 Number of extensions: 30 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 471 Length adjustment: 32 Effective length of query: 366 Effective length of database: 439 Effective search space: 160674 Effective search space used: 160674 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory