Align O-succinylhomoserine sulfhydrylase (EC 2.5.1.48) (characterized)
to candidate WP_011307392.1 MBAR_RS12885 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
Query= reanno::HerbieS:HSERO_RS16440 (413 letters) >NCBI__GCF_000195895.1:WP_011307392.1 Length = 457 Score = 246 bits (627), Expect = 1e-69 Identities = 141/420 (33%), Positives = 231/420 (55%), Gaps = 14/420 (3%) Query: 5 KTYGFTTTILHSDRQKGIEHGSLHKPIHTSVTFGYEDARQLAEVFQGKQPGYRYGRQGNP 64 ++ G +T +H+ + G+ PI+ + + ++DA + A++F ++ G Y R NP Sbjct: 36 ESLGVSTLAVHAGAKPDPATGARSVPIYQTAAYVFKDAEEAADLFGLRKEGNIYTRLMNP 95 Query: 65 TVAALEDKITKMEDGKSTICFATGMAAIGAIVQGLLREGDHVVSSAFLFGNTNSLW-MTV 123 T E +I +E G + A+GMAAI + R GD ++S L+G T L+ T Sbjct: 96 TTDVFEKRIAALEGGIGALAVASGMAAITTALLTFTRPGDEIISGDKLYGGTYELFNYTF 155 Query: 124 GAQGAKVSMVDATDVKNVEAAITANTRLVFVETIANPRTQVADLKRIGELCRERGILYVV 183 G V VD + + AI+ T+ ++VE+I NP + D +++ E+ GI +VV Sbjct: 156 PKLGRTVKFVDVGKPEEFKNAISEKTKAIYVESIGNPGLDIPDFEKLAEIAHGAGIPFVV 215 Query: 184 DNTMTSPYLFRPKTVGAGLVVNSLTKSIGGHGNALGGALTDTGEFDW--TRYPHIAE--- 238 DNT+ SP + RP G +VV S TK IGGHG ++GG + D+G F W ++P I E Sbjct: 216 DNTV-SPLILRPIDHGVDIVVYSATKFIGGHGTSIGGVIVDSGNFYWKPEKFPEICEPDP 274 Query: 239 -----NYKKNPAPQWGMAQIRAKALRDFGGSLGPEAAHHIAVGAETIALRQERECKNALA 293 YK+ +A+ R + +RD G + P + +G ET+ LR ++ C NAL Sbjct: 275 GYHGLKYKEAFGKAAFIAKARVQFIRDTGACISPFNSFLFTLGLETLPLRMKKHCDNALE 334 Query: 294 LAQMLQADERVAAVYYPGLESHPQHALSKALFRS-FGSLMSFELKDGI-DCFDYLNRLRL 351 +A+ L+ +V+ V YPGLESH + L+K +S +G+L+ F +K G +C ++ L + Sbjct: 335 IAKFLEKHPKVSWVSYPGLESHCSYELAKKYLKSGYGALIGFGIKGGARECKKFIEGLEI 394 Query: 352 AIPTSNLGDTRTLVIPVAHTIFYEMGAERRASMGIAESLIRVSVGLEDTDDLVADFRQAL 411 +N+GD ++LVI A T ++ E + + G+ E IR+S+G+ED DL++D +QAL Sbjct: 395 FSHLANIGDAKSLVIHPASTTHEQLSKEEQLACGVTEDFIRLSIGIEDAKDLISDIKQAL 454 Lambda K H 0.319 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 474 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 413 Length of database: 457 Length adjustment: 32 Effective length of query: 381 Effective length of database: 425 Effective search space: 161925 Effective search space used: 161925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory