Align Serine O-succinyltransferase; SST; EC 2.3.1.- (characterized)
to candidate WP_011307393.1 MBAR_RS12890 homoserine O-acetyltransferase
Query= SwissProt::A0A1D3PCM3 (517 letters) >NCBI__GCF_000195895.1:WP_011307393.1 Length = 579 Score = 218 bits (555), Expect = 5e-61 Identities = 144/435 (33%), Positives = 209/435 (48%), Gaps = 44/435 (10%) Query: 109 LDWGGLLPEFDIAYETWGQLNEKKDNVILLHTGLSASSHAHSTEA-NPKPGWWEKFIGPG 167 L+ G L I YE +G++N K NVIL+ L+ +HA + KPGWW IGP Sbjct: 38 LESGKTLSHVRIEYEMYGKMNADKSNVILVCHALTGDAHAAGFHTGDKKPGWWNIVIGPN 97 Query: 168 KTLDTDKYFVICTNVLGGCYGSTGPSTVDPSDGKKYATRFPILTIEDMVRAQFRLLDHLG 227 K DT++Y ++C+N++GGC GSTGPS+++P GK Y FPILTI DMV AQ +L++HLG Sbjct: 98 KAFDTERYCIVCSNIIGGCKGSTGPSSINPETGKPYGISFPILTIADMVNAQKKLVEHLG 157 Query: 228 VRKLYASVGSSMGGMQSLAAGVLFPERVGKIVSISGCARSHPYSIAMRHTQRQVLMMDPN 287 V++L+A G SMGGMQ L V +PE V K ++I+ A + P IA R+ + DP Sbjct: 158 VKQLFAVAGGSMGGMQVLQWTVSYPEMVKKAIAIATTASTTPQQIAFGAIGRKAITDDPK 217 Query: 288 WARGFYYDSIPPHSGMKLAREIATVTYRSGPEWEKRFGRKRADPSKQPALCPDFLIETYL 347 W G YY P G+ LAR I +TY S +K+FGR KQ + PD + Sbjct: 218 WNGGNYYGKKTPAQGLALARMIGHITYLSDASMQKKFGR-----DKQEKVGPD------M 266 Query: 348 DHAGEKFCLEYDANSLLYISKAMDLFDLGLTQQLATKKQRAEAQAKISSGTNTVNDASCS 407 K E + S T + + ++ +K SS T++ + S Sbjct: 267 PKISSKVSSEVSPAASSKTSSETSPETSSKTSSKTSSETSSKTSSKTSSKTSSKTSSETS 326 Query: 408 LTLPEQPYQEQ-PSASTSAEQSASASETG------------------------SAPNDLV 442 + + E P S+ + + + G S L+ Sbjct: 327 SETSSKTFSETFPDRSSHFQVESYLNHQGDTFTKRFDANSYLYITKAVDFFDLSKNGSLI 386 Query: 443 AGLAPLKDHQVLVIGVASDILFPAWQQREIAETLIQAG-NKTVEHIELGNDVSLFGHDTF 501 GL+ + + LVI + SD L+P +Q +EI L G + E I S +GHD F Sbjct: 387 EGLS-VVTAKYLVISITSDWLYPPYQSQEIVSALTANGVDAKYEEIR-----SQYGHDAF 440 Query: 502 LLDVKNVGGAVRKFL 516 LL+ + +R FL Sbjct: 441 LLEEGQLNYLIRGFL 455 Lambda K H 0.316 0.132 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 600 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 4 Number of HSP's successfully gapped: 3 Length of query: 517 Length of database: 579 Length adjustment: 36 Effective length of query: 481 Effective length of database: 543 Effective search space: 261183 Effective search space used: 261183 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory