Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_011307957.1 MBAR_RS16035 aminotransferase class V-fold PLP-dependent enzyme
Query= metacyc::HP_RS00540-MONOMER (380 letters) >NCBI__GCF_000195895.1:WP_011307957.1 Length = 394 Score = 346 bits (888), Expect = e-100 Identities = 185/391 (47%), Positives = 254/391 (64%), Gaps = 13/391 (3%) Query: 1 MRMQTKLIHGGISEDATTGAVSVPIYQTSTY-----RQDAI---GRHKGYEYSR--SGNP 50 ++ TK +H D GA + PI+QTST+ RQ A G GY Y+R P Sbjct: 5 VKFATKCVHAAEKPDPIFGAHTTPIFQTSTFIFENARQGAARFAGEESGYVYARIPPNTP 64 Query: 51 TRFALEELIADLEGGVKGFAFASGLAGIHAV-FSLLQSGDHVLLGDDVYGGTFRLFNQVL 109 T L E A LEGG G FASG+A + A+ + L+ GDH++ D VYG T+ LF+QVL Sbjct: 65 THAVLAEKFAALEGGEAGQTFASGMAAVTAIALTALKQGDHLISTDVVYGCTYSLFSQVL 124 Query: 110 VKNGLSCTIIDTSDISQIKKAIKPNTKALYLETPSNPLLKITDLAQCASVAKDHGLLTIV 169 G+ + +DTS +K+A KP TK ++LE+P+NP L + D+ + A +A+++ L +V Sbjct: 125 PGLGIEVSFVDTSKTENVKRAFKPETKMVFLESPANPTLNVCDIPEIARIARENEALCVV 184 Query: 170 DNTFATPYYQNPLLLGADIVAHSGTKYLGGHSDVVAGLVTTNNEALAQEIAFFQNAIGGV 229 DNTFATPY+Q PL LGAD+ S TKY+GGH+D++ G+V NN+ + ++ GG+ Sbjct: 185 DNTFATPYFQRPLELGADLSLSSCTKYIGGHADLLGGIVAGNNDFI-DRMSEVVGYTGGI 243 Query: 230 LGPQDSWLLQRGIKTLGLRMEAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNYELAKKQ 289 +GP ++WL RG+KTL +RME H +NA+ VAEFLE P+VE V YPGLP HP YELA+KQ Sbjct: 244 MGPHEAWLCIRGLKTLHIRMERHAENAMKVAEFLESRPEVEWVRYPGLPGHPQYELARKQ 303 Query: 290 MRGFSGMLSFTLKNDSEA-VAFVESLKLFILGESLGGVESLVGIPAFMTHACIPKTQREA 348 M GFSGMLSF +K EA ++++KL L SLG ++L+ PA MTHAC+P R++ Sbjct: 304 MSGFSGMLSFEVKGGIEAGRKLMDNVKLCSLAVSLGATDTLIQHPASMTHACVPHEVRKS 363 Query: 349 AGIRDGLVRLSVGIEHEQDLLEDLEQAFAKI 379 GI DGLVRLSVGIE +D++ DL+QA I Sbjct: 364 VGITDGLVRLSVGIEDPEDIIADLKQALEVI 394 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 435 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 394 Length adjustment: 30 Effective length of query: 350 Effective length of database: 364 Effective search space: 127400 Effective search space used: 127400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory