Align shikimate kinase (EC 2.7.1.71) (characterized)
to candidate WP_011317427.1 AVA_RS02800 shikimate kinase
Query= BRENDA::A0A0M3KL09 (179 letters) >NCBI__GCF_000204075.1:WP_011317427.1 Length = 181 Score = 117 bits (293), Expect = 1e-31 Identities = 69/166 (41%), Positives = 98/166 (59%), Gaps = 1/166 (0%) Query: 10 NIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGATIPWIFEKEGEVGFRTRETV 69 N+YL+G MGAGKTTVG LA+ LG FLD+D+ I + +I IF + GE GFR E+ Sbjct: 9 NLYLIGMMGAGKTTVGHLLAQELGYGFLDTDNVIAQAAKKSINEIFAEAGEAGFRQIESD 68 Query: 70 VLNELTSRKALVLATGGGAITQAPNREFLKQRGIVVYLYTPVELQLQRTYRDKNRPLLQV 129 VL ++ S L +ATGGG + + N +L G++V+L V++ R D RPLLQ Sbjct: 69 VLAQVCSYTKLTVATGGGIVLRRENWSYL-HHGLIVWLDVSVDILYARLAADTTRPLLQD 127 Query: 130 ENPEQKLRDLLKIRDPLYREVAHYTIETNQGAARDLAQKILQLILS 175 ++P+ KLR LL+ R PLY + + +A KI+Q+I S Sbjct: 128 DDPKGKLRSLLEQRTPLYSQADLRICVNAEETPEQIANKIMQVIPS 173 Lambda K H 0.318 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 93 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 179 Length of database: 181 Length adjustment: 19 Effective length of query: 160 Effective length of database: 162 Effective search space: 25920 Effective search space used: 25920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory