Align fused D-3-phosphoglycerate dehydrogenase / phosphoserine phosphatase (EC 1.1.1.95; EC 3.1.3.3) (characterized)
to candidate WP_011338899.1 RSPH17029_RS00105 phosphoglycerate dehydrogenase
Query= reanno::Cola:Echvi_2777 (630 letters) >NCBI__GCF_000015985.1:WP_011338899.1 Length = 534 Score = 207 bits (526), Expect = 1e-57 Identities = 122/327 (37%), Positives = 179/327 (54%), Gaps = 10/327 (3%) Query: 229 PKSRINVLLLENVHPIGVEIMKQEGYNVEVVSS-AMSEEELCEKIKNVSIIGIRSKTQIT 287 P VL+ + + V+I + G V+ + +E+L E I + IRS T++T Sbjct: 2 PDMAPRVLVSDELSETAVQIFRDRGVEVDYMPKLGKDKEKLAEIIGQYDGLAIRSATKVT 61 Query: 288 KKVLENANRLMAVGAFCIGTNQIDLETCQEKGIAVFNAPFSNTRSVVELAISEIIFLMRN 347 +K+LE A L +G IG + +D+ KG+ V N PF N+ + E AI+ + R Sbjct: 62 EKLLEQATNLKVIGRAGIGVDNVDIPAASRKGVIVMNTPFGNSITTAEHAIAMMFACARQ 121 Query: 348 LHDKTLKMHQGIWNKSASGSFEVRGKKLGIIGYGNIGAQLSVLAENMGMNVFYYD---IV 404 L + H G W KS E+ K LG+IG GNIG + A + M V YD Sbjct: 122 LPEANASTHAGKWEKSRFMGVELFNKTLGVIGAGNIGGIVCDRALGLSMKVVAYDPFLSE 181 Query: 405 ERLALGNATKIDSLDELLETCDIISLHVDGRTENKNILNKEKIFKMKKGAILVNLSRGHV 464 ER TK++ LD+LL D I+LHV + +NIL+ E I K KKG ++N +RG + Sbjct: 182 ERAKALGVTKVE-LDDLLARADFITLHVPLTDKTRNILSAEAIAKTKKGVRIINCARGGL 240 Query: 465 VDVPALRDALESGHLAGAAVDVFPTEPKNNDEPFESELIGCPNTILTPHIGGSTLEAQEN 524 VD AL +A++SGH+AGAA DVF EP + ES L PN ++TPH+G ST EAQEN Sbjct: 241 VDEKALAEAIKSGHVAGAAFDVFEVEPAS-----ESPLFNLPNVVVTPHLGASTTEAQEN 295 Query: 525 IAQFVPGKIIEYINSGNTFNSVNFPNI 551 +A V ++ +Y+ +G N++N P++ Sbjct: 296 VALQVAEQMSDYLLTGAVQNALNMPSV 322 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 663 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 630 Length of database: 534 Length adjustment: 36 Effective length of query: 594 Effective length of database: 498 Effective search space: 295812 Effective search space used: 295812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory