Align Putative asparagine synthetase [glutamine-hydrolyzing] 2; EC 6.3.5.4 (uncharacterized)
to candidate WP_011371836.1 SUDEN_RS01010 asparagine synthase (glutamine-hydrolyzing)
Query= curated2:Q58456 (515 letters) >NCBI__GCF_000012965.1:WP_011371836.1 Length = 655 Score = 213 bits (541), Expect = 2e-59 Identities = 142/431 (32%), Positives = 225/431 (52%), Gaps = 61/431 (14%) Query: 1 MCGINGIIRFGKEVIK-EEINKMNKAIKHRGPDDEGIFIYN---------------FKN- 43 MCGI G++ K + E N M K + HRGPD G ++ +KN Sbjct: 1 MCGIIGVVSLKKPSLNIEYTNAMIKTLHHRGPDGSGSCFFHTGCRHTKRISFFKAYYKNI 60 Query: 44 ---------YSIGLGHVRLAILDLSEKGHQPMGYNVDEDKIIYRDDELDRADIIIVYNGE 94 + + GH RL+I DLS HQPM +L + +I I YNGE Sbjct: 61 NTNELHPHDWDLFFGHTRLSIQDLSINAHQPMS-------------DLSQ-NIWITYNGE 106 Query: 95 IYNYLELKEKFNL---ETETGTDTEVILKLYNKLGFDCVKEFNGMWAFCIFDKKKGLIFC 151 IYN+ ELK + + ++ +DTEVI+ Y + G +C+K+FNGM+AF ++D K +F Sbjct: 107 IYNFKELKAELQICGHRFKSNSDTEVIIYSYIEWGIECIKKFNGMFAFALYDNFKKELFL 166 Query: 152 SRDRLGVKPFYYYWDGN-EFIFSSELKGILAVKEINKKENINKDAVELYFALGFIPSPYS 210 +RDR G+KP YY + + +F+SE K IL K+ + + ++K A+ YF I + + Sbjct: 167 TRDRYGIKPLYYTLNNDGTLLFASETKSILEYKDYSYE--VDKAALVEYFTFQNIFTDKT 224 Query: 211 IYKNTFKLEARQNLIFDLDKRE--IRKYYYWELPDYKP--IYDKKKLIEEGKKLLYDAVK 266 +++N L A + +L ++E ++ YW+ KP + D+++ EE +L AV Sbjct: 225 LHENIKLLPAGNYIKINLREKEHSLKTQQYWDFDFTKPLNLKDEREYTEELDRLFTQAVN 284 Query: 267 IRMRSDVPVGAFLSGGLDSSTVVGVMREFTDLSKLHTFSIGF--------EGKYDETPYI 318 ++ SDV VG++LSGG+DS + + + + L TF++GF E YDE Sbjct: 285 RQLVSDVEVGSYLSGGIDSGAIAAIASK--SIKNLKTFTVGFDLNSASGLELAYDERQKA 342 Query: 319 KIVVDYFKTQHHHYYFKERDFEELIDKYSWIYDEPFGDYSGFPTYKVSEMARKFVTVVLS 378 + + FKT+H+ K D E + +++ +EP S +P Y +++A KFV VVL+ Sbjct: 343 EYMSYLFKTEHYEMVLKSGDMERCLSDFTYHLEEPRVGQS-YPNYYANKLASKFVKVVLA 401 Query: 379 GDGGDEVFGGY 389 G G DE+F GY Sbjct: 402 GTGSDELFAGY 412 Lambda K H 0.322 0.144 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 952 Number of extensions: 68 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 655 Length adjustment: 36 Effective length of query: 479 Effective length of database: 619 Effective search space: 296501 Effective search space used: 296501 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)
Align candidate WP_011371836.1 SUDEN_RS01010 (asparagine synthase (glutamine-hydrolyzing))
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.6221.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-133 430.0 0.2 1.7e-131 425.7 0.2 2.0 1 lcl|NCBI__GCF_000012965.1:WP_011371836.1 SUDEN_RS01010 asparagine synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000012965.1:WP_011371836.1 SUDEN_RS01010 asparagine synthase (glutamine-hydrolyzing) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 425.7 0.2 1.7e-131 1.7e-131 1 517 [] 2 587 .. 2 587 .. 0.86 Alignments for each domain: == domain 1 score: 425.7 bits; conditional E-value: 1.7e-131 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaeg..vwkd........................e.k 42 Cgi+g+v lk+ + + e ++m++tl+hRGPD++g ++ + + + lcl|NCBI__GCF_000012965.1:WP_011371836.1 2 CGIIGVVSLKKPSL-NIEYTNAMIKTLHHRGPDGSGscFF-HtgcrhtkrisffkayyknintnelHpH 68 *********87644.6799***************994334.35*********************99768 PP TIGR01536 43 eenailghrRLaiidlseg.aQPlsnek.evvivfnGEIYNheeLreeleekGyeFetksDtEViLaay 109 + + +gh RL+i dls +QP+s+ + + +i++nGEIYN++eL++el+ G++F+++sDtEVi+ +y lcl|NCBI__GCF_000012965.1:WP_011371836.1 69 DWDLFFGHTRLSIQDLSINaHQPMSDLSqNIWITYNGEIYNFKELKAELQICGHRFKSNSDTEVIIYSY 137 899**************888******9999*************************************** PP TIGR01536 110 eewgeelverLeGmFAfalwdekkgelflaRDrlGikPLYyase.qgkllfaSEiKallalkeikaeld 177 ewg e++++++GmFAfal+d+ k+elfl RDr+GikPLYy+ + +g+llfaSE K++l+ k+ e+d lcl|NCBI__GCF_000012965.1:WP_011371836.1 138 IEWGIECIKKFNGMFAFALYDNFKKELFLTRDRYGIKPLYYTLNnDGTLLFASETKSILEYKDYSYEVD 206 ******************************************9999*********************** PP TIGR01536 178 kealaelltlqlvptektlfkevkelepakal.......dgeeklee..ywevekee..vkeseeelve 235 k+al+e++t+q+ t+ktl++++k l+++++ +++ k + yw+ + ++ ++e+e +e lcl|NCBI__GCF_000012965.1:WP_011371836.1 207 KAALVEYFTFQNIFTDKTLHENIKLLPAGNYIkinlrekEHSLK--TqqYWDFDFTKplNLKDEREYTE 273 ***********999****************99998885433444..355****9999888889999*** PP TIGR01536 236 elrelledavkkrlvadvpvgvllSGGlDSslvaaiakkeaksevktFsigfe.dskd.....ldeska 298 el++l+++av+++lv+dv+vg++lSGG+DS ++aaia+k +k ++ktF++gf+ +s++ +de + lcl|NCBI__GCF_000012965.1:WP_011371836.1 274 ELDRLFTQAVNRQLVSDVEVGSYLSGGIDSGAIAAIASKSIK-NLKTFTVGFDlNSASglelaYDERQK 341 ******************************************.8*********8766422333677779 PP TIGR01536 299 arkvadelgtehkevliseeevlkeleevilaleeptairasiplyllsklarekgvkVvLsGeGaDEl 367 a+ ++ + teh+e+++++ ++ l + ++leep + +s+p y + kla++ vkVvL G G+DEl lcl|NCBI__GCF_000012965.1:WP_011371836.1 342 AEYMSYLFKTEHYEMVLKSGDMERCLSDFTYHLEEPR-VGQSYPNYYANKLASKF-VKVVLAGTGSDEL 408 9999********************************9.999**************.************* PP TIGR01536 368 fgGYey.freakaeealelpease...laekkl....llqaklakes.elkellkakleeelkekeelk 427 f+GY + + +a ++ ++ e ++ ++l + + ++ + + k ++ +++ +++ +k+++ lcl|NCBI__GCF_000012965.1:WP_011371836.1 409 FAGYPWrYYRAVNNVDFD--EYINkyyEFWQRLipnrEICKVFKPIWgDVKDVCTRDIFADVFKKHSN- 474 ****85466666666666..223312222222223322223333333134445555555444433333. PP TIGR01536 428 kelkeeseleellrldlelllsdllrakDrvsmahslEvRvPflDkelvelalsipp............ 484 + ++ e ++++ l+ +++++l++ll ++D++smahslE RvPflD++lv++ +ip+ lcl|NCBI__GCF_000012965.1:WP_011371836.1 475 RLTSPEDYVNHSLYFEAKTFLHGLLVVEDKLSMAHSLETRVPFLDNDLVDFSQQIPVnlklsnlqniis 543 3333348999***********************************************999999999999 PP TIGR01536 485 .........elklr..dgkeKvlLreaaeellPeeileRkKeaf 517 ++k +++ K +Lre+a +++P++i + K++f lcl|NCBI__GCF_000012965.1:WP_011371836.1 544 mnenetgnkQHKYFqkSNDGKNILRETASRYIPNNITTLTKQGF 587 99999998844443358999*****************9999998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (655 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.06u 0.01s 00:00:00.06 Elapsed: 00:00:00.06 # Mc/sec: 5.17 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory