Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate WP_011372106.1 SUDEN_RS02470 histidinol-phosphate aminotransferase
Query= curated2:A6Q1Z5 (366 letters) >NCBI__GCF_000012965.1:WP_011372106.1 Length = 364 Score = 454 bits (1168), Expect = e-132 Identities = 221/359 (61%), Positives = 283/359 (78%), Gaps = 1/359 (0%) Query: 1 MRFNETLEKIKTYEAGKPIELVVREFGIEPQNIIKLASNENPYGTSPKVVDAVREIADTM 60 M+FN+ L+ IKTYEAGKPIELVVRE+GIEPQ+I+KLASNENP G SPKV+DAV +I M Sbjct: 1 MKFNKHLQNIKTYEAGKPIELVVREYGIEPQDIVKLASNENPLGCSPKVIDAVGKILTKM 60 Query: 61 YMYPDDSMFELKSALAKRFEIDQKNIIIGAGSDQVLEFCARAVLNEKSSVLMSKITFAMY 120 +YPDDSM LK+AL+KR+ +D +N+IIG+GSDQV+EF A + S +LM+ ITFAMY Sbjct: 61 SLYPDDSMISLKNALSKRYNVDSENVIIGSGSDQVIEFLIHAKAHSGSKILMNSITFAMY 120 Query: 121 EIYALQQGAKIIRSSCYRHDLEEFYDLYKKHHPDIIHICTPNNPTGDALDAEYLYSFLDN 180 EIY+ GA +IR+S HDL+EFY+LYK+ P+II ICTPNNPTGDALDA+ +Y+FL+ Sbjct: 121 EIYSKHVGADVIRTSSQEHDLDEFYELYKQEKPEIIFICTPNNPTGDALDAQKIYNFLEK 180 Query: 181 V-QEPLVIVDGAYMEYAAFKDEKKRIHPQDLIKKYPNVIYLGTFSKAYGLGGMRVGYGIA 239 + + LV+VD AYMEYA KD KK I+ ++LI+K+ NVIYLGTFSKAYGLGGMRVGYGI+ Sbjct: 181 IDNDTLVVVDAAYMEYAIVKDAKKEINVKELIQKHSNVIYLGTFSKAYGLGGMRVGYGIS 240 Query: 240 DQSVIGQLYKLRPPFNITTLSLKAATTALEDEGFVQYSIEQNFLQMERFVNFALQNGFEF 299 + +I +LYKLRPPFNITTLSL+AAT AL DE FVQ S N QM+R+ FA + + Sbjct: 241 EAKIIKELYKLRPPFNITTLSLEAATVALSDEEFVQKSTALNLEQMKRYEEFAKEQKIDI 300 Query: 300 IDSYTNFITYLLPENRKSKSLSEALLKRGVIVRDLTGYGMNALRITVGTKEQNDRFFEI 358 I+SYTNF+T L N+ S ++ LL+ G+IVRDL+ Y MNA+R+T+GT+EQN RFF++ Sbjct: 301 INSYTNFVTLSLGSNQNSTKIASQLLQNGMIVRDLSSYNMNAIRVTIGTQEQNSRFFKL 359 Lambda K H 0.320 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 487 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 364 Length adjustment: 30 Effective length of query: 336 Effective length of database: 334 Effective search space: 112224 Effective search space used: 112224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_011372106.1 SUDEN_RS02470 (histidinol-phosphate aminotransferase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.10266.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-107 345.7 4.0 1.5e-107 345.5 4.0 1.0 1 lcl|NCBI__GCF_000012965.1:WP_011372106.1 SUDEN_RS02470 histidinol-phospha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000012965.1:WP_011372106.1 SUDEN_RS02470 histidinol-phosphate aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 345.5 4.0 1.5e-107 1.5e-107 2 345 .. 5 359 .. 4 363 .. 0.96 Alignments for each domain: == domain 1 score: 345.5 bits; conditional E-value: 1.5e-107 TIGR01141 2 ekikklepYqpg......arelgek..evvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelke 62 +++++++ Y++g re+g++ ++vkL+snEnP+g+s+kv++a+ + l+k+ +Ypd++++ lk+ lcl|NCBI__GCF_000012965.1:WP_011372106.1 5 KHLQNIKTYEAGkpielvVREYGIEpqDIVKLASNENPLGCSPKVIDAVGKILTKMSLYPDDSMISLKN 73 789***************9*****999****************************************** PP TIGR01141 63 alakylgveeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqe 131 al+k+++v+ en+++g Gsd++ie+li+a +++g ++l+++ t++mYe+++k ga+v+ ++ +e+ + lcl|NCBI__GCF_000012965.1:WP_011372106.1 74 ALSKRYNVDSENVIIGSGSDQVIEFLIHAKAHSGSKILMNSITFAMYEIYSKHVGADVIRTSSQEHDLD 142 ***************************************************************999656 PP TIGR01141 132 dleavleaakekvklvflasPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee......asvl 193 ++ +++ ++ek++++f+++PnnPtG l++++i ++le+ +d+lVVvD AY+e++ +v lcl|NCBI__GCF_000012965.1:WP_011372106.1 143 EFYELY--KQEKPEIIFICTPNNPTGDALDAQKIYNFLEKIdNDTLVVVDAAYMEYAIVkdakkeINVK 209 655555..99*******************************77*************9777788888999 PP TIGR01141 194 ellaeypnlvvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiekt 262 el+++++n+++l T+SKa+gL+g+RvGy+i++a+ii++l k+r+p+n+++l+leaa+ al+d+++++k+ lcl|NCBI__GCF_000012965.1:WP_011372106.1 210 ELIQKHSNVIYLGTFSKAYGLGGMRVGYGISEAKIIKELYKLRPPFNITTLSLEAATVALSDEEFVQKS 278 ********************************************************************* PP TIGR01141 263 veevkkererlleelkkleglevyeSkaNFvlikvke..daeelleallekgiivRdlksaeglleecl 329 ++ + ++++r++e++k+ ++++++S++NFv++ + + ++++++ +ll++g+ivRdl+s+ ++ +++ lcl|NCBI__GCF_000012965.1:WP_011372106.1 279 TALNLEQMKRYEEFAKEQ-KIDIINSYTNFVTLSLGSnqNSTKIASQLLQNGMIVRDLSSY-NM--NAI 343 **************9999.7*************997777999*****************99.55..*** PP TIGR01141 330 RitvGtreenerllea 345 R+t+Gt+e+n r+++ lcl|NCBI__GCF_000012965.1:WP_011372106.1 344 RVTIGTQEQNSRFFKL 359 *************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 6.95 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory