Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_011372131.1 SUDEN_RS02595 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_000012965.1:WP_011372131.1 Length = 430 Score = 250 bits (639), Expect = 1e-70 Identities = 154/432 (35%), Positives = 234/432 (54%), Gaps = 15/432 (3%) Query: 364 ASDKVGVQKALSRPIQKTSEIMHLVNPIIENVRDKGNSALLEYTEKFDG---VKLSNPVL 420 +S K ++ L R + + V II+ ++ N AL E+ KFD V + + Sbjct: 9 SSFKAEFKELLERGKMDIAHVSATVGTIIDEIKSNKNQALKEHITKFDKWTPVSDEDLKI 68 Query: 421 NAPFPEEYFEGLTEEMKEALDLSIENVRKFHAAQLPTETLEVETQPGVLCSRFPRPIEKV 480 + +E L + +K AL LS + ++ +H Q P + E +L R P++ Sbjct: 69 STESMSRAYENLDKALKAALHLSYDRIKAYHEKQKPRSWFDDEPNGTILGQRVT-PVDSA 127 Query: 481 GLYIPGGTAILPSTALMLGVPAQVAQCKEIVFASPPRKSDGKVSPEVVYVA-EKVGASKI 539 GLYIPGG A PS+ LM +PAQVA + IV +P +++ E++ A G S++ Sbjct: 128 GLYIPGGKAAYPSSLLMNVIPAQVAGVQNIVVCTPTPENEPN---ELLLAACHLCGVSEV 184 Query: 540 VLAGGAQAVAAMAYGTETIPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVL 599 GGA A+AAMAYGTETIPKVD I GPGN FV AK V D +IDM AGPSE+ Sbjct: 185 YKVGGASAIAAMAYGTETIPKVDVITGPGNIFVATAKKMVFGDV----NIDMIAGPSEIG 240 Query: 600 VIADEDADVDFVASDLLSQAEHGIDSQVILVGVNLSEKKIQEIQDAVHNQALQLPRVDIV 659 ++AD+ A+ +A D+LSQAEH D + + S+K I+ + N LPR I Sbjct: 241 ILADDSANPSHMAVDMLSQAEH--DEMASSILITPSQKLADAIKAEIENWLKILPRQKIA 298 Query: 660 RKCIA-HSTIVLCDGYEEALEMSNQYAPEHLILQIANANDYVKLVDNAGSVFVGAYTPES 718 R+ I I++ +EA+++ N+ APEHL + + + + L+ +AG++F+G TPE+ Sbjct: 299 RESIEKRGAIIVTSDMQEAIDLMNEIAPEHLEVATLSPFELLPLIKHAGAIFLGHNTPEA 358 Query: 719 CGDYSSGTNHTLPTYGYARQYSGANTATFQKFITAQNITPEGLENIGRAVMCVAKKEGLD 778 GDY +G NHTLPT G A+ +S F K + + + + + IG +AK EGL Sbjct: 359 VGDYMAGPNHTLPTGGTAKFFSPLGVENFMKKTSIISFSAKAINEIGEECALIAKIEGLT 418 Query: 779 GHRNAVKIRMSK 790 H ++++R+ K Sbjct: 419 AHEQSIRVRLVK 430 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 696 Number of extensions: 40 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 430 Length adjustment: 37 Effective length of query: 762 Effective length of database: 393 Effective search space: 299466 Effective search space used: 299466 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory