Align N-succinyldiaminopimelate-aminotransferase (EC 2.6.1.17) (characterized)
to candidate WP_011372391.1 SUDEN_RS03970 hypothetical protein
Query= metacyc::MONOMER-6501 (397 letters) >NCBI__GCF_000012965.1:WP_011372391.1 Length = 378 Score = 235 bits (600), Expect = 1e-66 Identities = 141/382 (36%), Positives = 207/382 (54%), Gaps = 15/382 (3%) Query: 10 PYPFEKLRALLADAGKPTHDLPPINLSIGEPKHAAPACVGQAIAANLAGLSVYPSTKGEP 69 PYPFEKL LL P + L+IGEP+ P + +A+ + A L YP T GE Sbjct: 5 PYPFEKLNTLLQGI-TPNSEYESSILTIGEPQFETPHFIQKALCNSAAQLRKYPKTAGED 63 Query: 70 ALRQAISQWLSRRYSIPAPDPESEVLPVLGSREALFAFAQTVIDPSAGALVVCPNPFYQI 129 LR+A +++ +R+++ D E++P G+RE LF F Q + + NPFYQI Sbjct: 64 ELREAQREFVEKRFNVKLTD--KEIIPTFGTREVLFNFPQFFLFDKKEPTIAFTNPFYQI 121 Query: 130 YEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSPGNPAGNVMSLEEWR 189 YEGAA+ + A Y+N F + +E LV + SP NP + +SLEE Sbjct: 122 YEGAAIASRAKSIYLNLTQENGF---KPEIDEEKLSSCHLVILNSPNNPTTSTLSLEELS 178 Query: 190 TLFELSDRHGFVIAAYECYSEIYLDEDTPPLGSLQAARRLGRDRYTNLVAFSSLSKRSNV 249 +L+ ++ FV+ ECYSEIY TP L L+A+ +G + N++ +S+SKRS+ Sbjct: 179 IWVKLALKYDFVLLNDECYSEIYTKNPTPSL--LEASLHVGNSSFKNVLVINSISKRSSA 236 Query: 250 PGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAWSMRRMCRKTAQ-YRAKFEA 308 PG+RSGF+AGD +L ++ YRTY G A + +A+ AAW + + Y+ FEA Sbjct: 237 PGLRSGFIAGDENILREYINYRTYIGCASPLPLQSAAAAAWREEEHVEEAREIYKKNFEA 296 Query: 309 VLPILQNVLDVRAPQASFYLWAGTPGSDTAFARELYGRTGVTVLPGSLLAREAHNA-NPG 367 + +L++ P+A+FYLW P + F ++LY V VLPG L R+ N NPG Sbjct: 297 A----REILEIEIPEATFYLWLRVPNA-LEFTKKLYKNYNVKVLPGEYLGRDDENGFNPG 351 Query: 368 QGRIRIALVAPLDQCVQAAERI 389 + IRIALV + A +RI Sbjct: 352 KDFIRIALVEDTQKIKSALKRI 373 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 20 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 378 Length adjustment: 30 Effective length of query: 367 Effective length of database: 348 Effective search space: 127716 Effective search space used: 127716 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory