Align 3-isopropylmalate dehydrogenase; 3-IPM-DH; Beta-IPM dehydrogenase; IMDH; EC 1.1.1.85 (characterized)
to candidate WP_011372731.1 SUDEN_RS05780 3-isopropylmalate dehydrogenase
Query= SwissProt::Q56268 (358 letters) >NCBI__GCF_000012965.1:WP_011372731.1 Length = 355 Score = 400 bits (1027), Expect = e-116 Identities = 201/351 (57%), Positives = 261/351 (74%), Gaps = 5/351 (1%) Query: 3 KIAIFAGDGIGPEIVAAARQVLDAVDQAAHLGLRCTEGLVGGAALDASDDPLPAASLQLA 62 KIA+ GDGIGPEI+ A +VLDAV L E L+GG A D + DPLP ++ ++ Sbjct: 5 KIALIKGDGIGPEIIDEAVKVLDAVASCCDLEFSYEEALMGGCAYDITGDPLPQETINIS 64 Query: 63 MAADAVILGAVGGPRWDAYPPAKRPEQGLLRLRKGLDLYANLRPAQIFPQLLDASPLRPE 122 + +DAV+ GA+GG +WD P KRPE GLLR RK L +YANLRPA +F +L++AS L+ E Sbjct: 65 LNSDAVLFGAIGGAKWDNLPREKRPESGLLRFRKELGVYANLRPANVFDELINASSLKAE 124 Query: 123 LVRDVDILVVRELTGDIYFGQPRGLEVIDGKRRGFNTMVYDEDEIRRIAHVAFRAAQGRR 182 +++ VD++VVREL G IYFG+P+G + + RG+NTMVY +EI RIAH AF+ A R Sbjct: 125 VIKGVDLMVVRELIGGIYFGEPKGRD----ENRGWNTMVYTREEIVRIAHQAFKIAMSRS 180 Query: 183 KQLCSVDKANVLETTRLWREVVTEVARDYPDVRLSHMYVDNAAMQLIRAPAQFDVLLTGN 242 K++CS+DKANVL+ ++LWREVV EVA++YP+V L+HMYVDNAAMQLIR P QFDV+LTGN Sbjct: 181 KRVCSIDKANVLDVSQLWREVVIEVAKEYPEVELTHMYVDNAAMQLIRDPRQFDVMLTGN 240 Query: 243 MFGDILSDEASQLTGSIGMLPSASLGEGRAMYEPIHGSAPDIAGQDKANPLATILSVAMM 302 +FGDILSDEAS L+GSIG+LPSAS+G +YEPIHGSAPDIAGQ ANP+ATILS +MM Sbjct: 241 IFGDILSDEASMLSGSIGLLPSASVGAKIGVYEPIHGSAPDIAGQGIANPIATILSASMM 300 Query: 303 LRHSLNAEPWAQRVEAAVQRVLDQGLRTADIAA-PGTPVIGTKAMGAAVVN 352 LR++L A +++AAV+R L +G RT D+A V T MG+ + N Sbjct: 301 LRYALGEHGAADKIDAAVKRALKEGYRTKDLAQYDAKEVCSTSEMGSIIAN 351 Lambda K H 0.320 0.137 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 355 Length adjustment: 29 Effective length of query: 329 Effective length of database: 326 Effective search space: 107254 Effective search space used: 107254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_011372731.1 SUDEN_RS05780 (3-isopropylmalate dehydrogenase)
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00169.hmm # target sequence database: /tmp/gapView.5353.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00169 [M=349] Accession: TIGR00169 Description: leuB: 3-isopropylmalate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-159 515.8 0.1 3e-159 515.6 0.1 1.0 1 lcl|NCBI__GCF_000012965.1:WP_011372731.1 SUDEN_RS05780 3-isopropylmalate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000012965.1:WP_011372731.1 SUDEN_RS05780 3-isopropylmalate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 515.6 0.1 3e-159 3e-159 1 346 [. 5 346 .. 5 349 .. 0.98 Alignments for each domain: == domain 1 score: 515.6 bits; conditional E-value: 3e-159 TIGR00169 1 kiavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadavLlg 69 kia+++GDgiGpe+++ea+kvL+av+ +l++ +eeal+GG a d tg+Plp+et++ + ++davL+g lcl|NCBI__GCF_000012965.1:WP_011372731.1 5 KIALIKGDGIGPEIIDEAVKVLDAVASCCDLEFSYEEALMGGCAYDITGDPLPQETINISLNSDAVLFG 73 79******************************************************************* PP TIGR00169 70 avGGpkWdnlprdvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvvreLtgGiY 138 a+GG kWdnlpr++rPe+gLL+ rkel+++anLrPa++f++L+++s+lk+e++kgvDl+vvreL+gGiY lcl|NCBI__GCF_000012965.1:WP_011372731.1 74 AIGGAKWDNLPREKRPESGLLRFRKELGVYANLRPANVFDELINASSLKAEVIKGVDLMVVRELIGGIY 142 ********************************************************************* PP TIGR00169 139 fGepkereeaeeekkaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlWrktveeiak 207 fGepk+r+e +++++t++Yt+eei ria++af++a+ r k+v+s+DkanvL++s+lWr++v e+ak lcl|NCBI__GCF_000012965.1:WP_011372731.1 143 FGEPKGRDE----NRGWNTMVYTREEIVRIAHQAFKIAMSRSKRVCSIDKANVLDVSQLWREVVIEVAK 207 ********9....69****************************************************** PP TIGR00169 208 eyPdvelehlyiDnaamqLvksPeqldvvvtsnlfGDilsDeasvitGslGlLPsaslsskglalfepv 276 eyP+vel h+y+DnaamqL+++P+q+dv++t+n+fGDilsDeas+++Gs+GlLPsas++ ++ +++ep+ lcl|NCBI__GCF_000012965.1:WP_011372731.1 208 EYPEVELTHMYVDNAAMQLIRDPRQFDVMLTGNIFGDILSDEASMLSGSIGLLPSASVG-AKIGVYEPI 275 ***********************************************************.8899***** PP TIGR00169 277 hgsapdiagkgianpiaailsaalllryslnleeaaeaieaavkkvleegkrtedlaseattav.stke 344 hgsapdiag+gianpia+ilsa+++lry+l+ + aa++i+aavk++l+eg+rt+dla+ ++++v st+e lcl|NCBI__GCF_000012965.1:WP_011372731.1 276 HGSAPDIAGQGIANPIATILSASMMLRYALGEHGAADKIDAAVKRALKEGYRTKDLAQYDAKEVcSTSE 344 ********************************************************9987776625666 PP TIGR00169 345 ve 346 ++ lcl|NCBI__GCF_000012965.1:WP_011372731.1 345 MG 346 65 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (355 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 11.51 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory