Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate WP_011372856.1 SUDEN_RS06425 4-hydroxy-tetrahydrodipicolinate synthase
Query= BRENDA::O67216 (294 letters) >NCBI__GCF_000012965.1:WP_011372856.1 Length = 297 Score = 240 bits (612), Expect = 3e-68 Identities = 125/290 (43%), Positives = 186/290 (64%), Gaps = 4/290 (1%) Query: 4 GSIVALITPFKEGEVDYEALGNLIEFHVDNGTDAILVCGTTGESPTLTFEEHEKVIEFAV 63 GS ALITPFK G++D A NLI+ ++NG +A+ GTTGES TL++ E ++ IE AV Sbjct: 6 GSTTALITPFKNGKLDESAYANLIKRQINNGINAVCPVGTTGESATLSYAEDKRCIEIAV 65 Query: 64 KRAAGRI-KVIAGTGGNATHEAVHLTAHAKEVGADGALVVVPYYNKPTQRGLYEHFKTVA 122 + G KV+AG G N+T EA+ A++ G D V PYY KP+Q GLY+H+K +A Sbjct: 66 EICRGTATKVLAGAGSNSTSEAIEAAITAQKCGVDAIFSVAPYYVKPSQEGLYQHYKAIA 125 Query: 123 QEV-DIPIIIYNIPSRTCVEISVDTMFKLASECENIVASKESTPNMDRISEIVKRLGESF 181 + V D+P ++YN+P RT V+IS DT+ +L + +NI KE+T +++R E++ R E Sbjct: 126 ESVSDMPFMLYNVPGRTVVDISADTVIRLFDDVKNIYGIKEATGSLERTVELLSRRPE-L 184 Query: 182 SVLSGDDSLTLPMMALGAKGVISVANNVMPREVKELIRAALEGDFRRAREIHYYLHDLFK 241 V SGDD++ P++A G G+ SV +N++P EL++ AL GDF ++ I+ L + K Sbjct: 185 KVFSGDDAIDYPILANGGAGITSVTSNLLPDLKSELVKKALNGDFTGSKAINDMLFPINK 244 Query: 242 VLFIETNPIPVKTACWMLGMCEK-EFRLPLTEMSPENENKLREVLKKYNL 290 LFIE+NPI +K A ++ G+ + E+RLPL S EN K+ V+K Y + Sbjct: 245 ALFIESNPIMIKAAMYIAGLIDTLEYRLPLVAPSVENMKKIESVMKNYEI 294 Lambda K H 0.318 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 297 Length adjustment: 26 Effective length of query: 268 Effective length of database: 271 Effective search space: 72628 Effective search space used: 72628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_011372856.1 SUDEN_RS06425 (4-hydroxy-tetrahydrodipicolinate synthase)
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.28121.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-105 337.5 0.2 2.6e-105 337.3 0.2 1.0 1 lcl|NCBI__GCF_000012965.1:WP_011372856.1 SUDEN_RS06425 4-hydroxy-tetrahyd Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000012965.1:WP_011372856.1 SUDEN_RS06425 4-hydroxy-tetrahydrodipicolinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 337.3 0.2 2.6e-105 2.6e-105 2 285 .. 7 291 .. 6 292 .. 0.98 Alignments for each domain: == domain 1 score: 337.3 bits; conditional E-value: 2.6e-105 TIGR00674 2 vltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvkn.rvp 69 + tAliTPfk+ + +d +a+++li++qi++g++a+ +vGtTGEsatLs+ E k++ie+ave++++ + lcl|NCBI__GCF_000012965.1:WP_011372856.1 7 STTALITPFKNGK-LDESAYANLIKRQINNGINAVCPVGTTGESATLSYAEDKRCIEIAVEICRGtATK 74 789*******988.*************************************************985689 PP TIGR00674 70 viaGtgsnateeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeev.elPiilYnvPsRtg 137 v+aG+gsn+t+eaie + +a+k+gvd++++v+PyY+kP+qeGly+h+kaiae+v ++P +lYnvP+Rt+ lcl|NCBI__GCF_000012965.1:WP_011372856.1 75 VLAGAGSNSTSEAIEAAITAQKCGVDAIFSVAPYYVKPSQEGLYQHYKAIAESVsDMPFMLYNVPGRTV 143 ****************************************************9879************* PP TIGR00674 138 vslepetvkrLaeeve.ivaiKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasn 205 v+++ +tv+rL+++v+ i +iKea+g+ler +e+ ++ + ++kv+sGdDa+ +ila G++G+ SV+sn lcl|NCBI__GCF_000012965.1:WP_011372856.1 144 VDISADTVIRLFDDVKnIYGIKEATGSLERTVELLSRRP-ELKVFSGDDAIDYPILANGGAGITSVTSN 211 *************9999*******************998.9**************************** PP TIGR00674 206 vapkelkemvkaalegdteeareihqkllklfkalfietNPipvKtalallgliekdelRlPLtelsee 274 ++p++ +e+vk+al+gd++ + i+ l+++ kalfie+NPi +K+a++++gli + e+RlPL++ s e lcl|NCBI__GCF_000012965.1:WP_011372856.1 212 LLPDLKSELVKKALNGDFTGSKAINDMLFPINKALFIESNPIMIKAAMYIAGLIDTLEYRLPLVAPSVE 280 ********************************************************************* PP TIGR00674 275 kkeklkevlke 285 + +k+++v+k+ lcl|NCBI__GCF_000012965.1:WP_011372856.1 281 NMKKIESVMKN 291 ********997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (297 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.90 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory