Align Succinylornithine transaminase; SOAT; EC 2.6.1.81; Succinylornithine aminotransferase (uncharacterized)
to candidate WP_011372884.1 SUDEN_RS06570 aspartate aminotransferase family protein
Query= curated2:Q3Z295 (406 letters) >NCBI__GCF_000012965.1:WP_011372884.1 Length = 394 Score = 256 bits (653), Expect = 1e-72 Identities = 145/380 (38%), Positives = 223/380 (58%), Gaps = 8/380 (2%) Query: 12 EWMIPVYAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKF 71 ++++P YA A V G + + D GK+YIDFA GIAV ++GHA+ + +A+ +Q S Sbjct: 10 KYVLPTYARADVEFVSGNNAIVVDANGKKYIDFASGIAVCSVGHANKRVNDAICKQLSNI 69 Query: 72 WHTGNGYTNEPVLRLAKKLIDATFAD-RVFFCNSGAEANEAALKLARKFAHDRYGSHKSG 130 HT N Y P + A+K+++A+ D + FF NSGAEANE A+K+ARKF + Sbjct: 70 THTSNLYYIAPQAKAAQKIVEASGYDMKCFFGNSGAEANEGAIKIARKFGEKDGELKRYK 129 Query: 131 IVAFKNAFHGRTLFTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVIVE 190 ++ +++FHGRT+ TV A GQ F P P +A ++I+ ++L+DD TCAV++E Sbjct: 130 VITLQHSFHGRTITTVKATGQEKMHNYFGPYPDGFVYA--DNIDHVASLVDDHTCAVMIE 187 Query: 191 PIQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTT 250 +QGEGGV P +Q L + N LLI DEVQTG+ RTG+ A +Y + PD++T Sbjct: 188 LVQGEGGVQPLDRDSVQKLAKFLKEKNVLLIIDEVQTGIYRTGKFLASNYYDIKPDVVTL 247 Query: 251 AKALGGGFPVGALLTTEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQ 310 AK LGGG P+G ++TT V G HG+T+GGN L++ A +V++++N +++ Sbjct: 248 AKGLGGGVPIGVVMTT--LKDVFGAGDHGSTFGGNFLSTTAACEVVDILNEMNESGELQK 305 Query: 311 RHDWFVERLNTI-NHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAG 369 D+F L N +F+ G+G++ C L +I A + GV+VL AG Sbjct: 306 GIDYFDSELEKFYNAHRDIFTSKVGIGMM--CGLRVKDGDTLTKIISNAREEGVIVLKAG 363 Query: 370 GNVVRFAPALNVSEEEVTTG 389 + +R PAL +++EE+ G Sbjct: 364 RDTLRLLPALTITKEEIDEG 383 Lambda K H 0.319 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 394 Length adjustment: 31 Effective length of query: 375 Effective length of database: 363 Effective search space: 136125 Effective search space used: 136125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory