Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate WP_011373074.1 SUDEN_RS07550 succinyl-diaminopimelate desuccinylase
Query= BRENDA::O25002 (383 letters) >NCBI__GCF_000012965.1:WP_011373074.1 Length = 365 Score = 332 bits (851), Expect = 1e-95 Identities = 172/381 (45%), Positives = 250/381 (65%), Gaps = 22/381 (5%) Query: 1 MDALEITQKLISYPTITPKECGIFEYIKSLFPHFKTLECGENGVKNLFLYRIFNPPKDHA 60 M +E+ + +IS + TP + G+ ++I++ F+ + GVKNLFLY+ F+ Sbjct: 1 MKTIELFKFMISAKSQTPDDGGLLDFIQNYLDDFEAIRVDVEGVKNLFLYKKFSQGD--- 57 Query: 61 EEKHAKENTKPLHFCFAGHIDVVPPGNHWQSDPFKPVIKEGFLYGRGAQDMKGGVGAFLS 120 H CFAGH+DVVP G+ W SDP+ ++G++YGRGAQDMK GV AF+ Sbjct: 58 ------------HLCFAGHVDVVPAGDGWDSDPYIATERDGYIYGRGAQDMKSGVAAFVQ 105 Query: 121 A---SLNFNPKTPFLLSILLTSDEEGPGIFGTRLMLEKLKEKDLLPHMAIVAEPTCEKVL 177 A + +FN LS+LLTSDEEG G +GT +L L++K +LP A+VAEPTCE V Sbjct: 106 AIKDTKHFNGT----LSLLLTSDEEGEGTYGTIEVLNYLRDKSMLPDFAVVAEPTCEMVF 161 Query: 178 GDSIKIGRRGSINGKLILKGVQGHVAYPQKCQNPIDTLASVLPLISGVNLDNGDEYFDPS 237 GD+IK+GRRGSING + L+G QGH AYP+K NPI+ +A L ++GV+LDNGDE+F PS Sbjct: 162 GDAIKVGRRGSINGYITLRGKQGHAAYPEKSINPINLIAPKLANMAGVDLDNGDEFFSPS 221 Query: 238 KLVITNLHAGLGANNITPASVEIIFNARHSLKTTKESLKEYLEKVLKDLPYTLELESSSS 297 K VIT++ AG+ N+TP ++++FN R++ T+++ ++E++EK L+DL Y L L S Sbjct: 222 KFVITDIRAGMQVTNVTPNELKMMFNVRNTTLTSQKEIREFVEKNLEDLDYDLRLTQGSY 281 Query: 298 PFITASHSKLTSVLKENILKTCHTTPLLNTKGGTSDARFFSAHGIEVVEFGVINDRIHAI 357 PF T + +KL + +I + P +T GGTSDAR + GI+V+EFGVIND IHAI Sbjct: 282 PFKTDTKTKLVKNIDASIEQISGIKPKHSTAGGTSDARHMAPLGIDVIEFGVINDTIHAI 341 Query: 358 DERVSLKELELLEKVFLGVLE 378 +ER + E++ L +VF +++ Sbjct: 342 NERTTKDEVKKLYEVFKHLID 362 Lambda K H 0.318 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 365 Length adjustment: 30 Effective length of query: 353 Effective length of database: 335 Effective search space: 118255 Effective search space used: 118255 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_011373074.1 SUDEN_RS07550 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.10786.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-133 429.5 0.1 6.1e-133 429.3 0.1 1.0 1 lcl|NCBI__GCF_000012965.1:WP_011373074.1 SUDEN_RS07550 succinyl-diaminopi Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000012965.1:WP_011373074.1 SUDEN_RS07550 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 429.3 0.1 6.1e-133 6.1e-133 3 368 .. 5 362 .. 3 364 .. 0.98 Alignments for each domain: == domain 1 score: 429.3 bits; conditional E-value: 6.1e-133 TIGR01246 3 elakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgt.eepvlvfaGhtDvvPaG 70 el k +is ks tP+d g +++i++ L +fe+ ++ +e++knl++ +++ + ++l+faGh+DvvPaG lcl|NCBI__GCF_000012965.1:WP_011373074.1 5 ELFKFMISAKSQTPDDGGLLDFIQNYLD--DFEAIRVDVEGVKNLFLYKKFsQGDHLCFAGHVDVVPAG 71 788899**********************..*****************99997889************** PP TIGR01246 71 elekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtk 139 + W+sdp+ ++erdG++ygrGa+Dmk+++aafv+a + + ++G+lsll+tsDeege +Gt+ lcl|NCBI__GCF_000012965.1:WP_011373074.1 72 --DGWDSDPYIATERDGYIYGRGAQDMKSGVAAFVQAIK----DTKHFNGTLSLLLTSDEEGEGTYGTI 134 ..99********************************977....8999********************** PP TIGR01246 140 kvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvl 208 +v+++l+++++l+d+avv+eP+++ GD ik+GrrGsi+g ++++G+qGh aYP+k++nP++ ++p l lcl|NCBI__GCF_000012965.1:WP_011373074.1 135 EVLNYLRDKSMLPDFAVVAEPTCEMVFGDAIKVGRRGSINGYITLRGKQGHAAYPEKSINPINLIAPKL 203 ********************************************************************* PP TIGR01246 209 keliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildkhkl 277 ++++ ++lD+G+eff+ps++ i++i+ag++++nv+P+elk++fn+r+++ +s++e+++ vek l++ l lcl|NCBI__GCF_000012965.1:WP_011373074.1 204 ANMAGVDLDNGDEFFSPSKFVITDIRAGMQVTNVTPNELKMMFNVRNTTLTSQKEIREFVEKNLED--L 270 **************************************************************9998..* PP TIGR01246 278 dYelewklsgepfltk.egklikkvaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtih 345 dY+l++++ + pf t+ + kl+k++ ++ie+++++kp+ st+GGtsDar++a lg +v+e+G++ndtih lcl|NCBI__GCF_000012965.1:WP_011373074.1 271 DYDLRLTQGSYPFKTDtKTKLVKNIDASIEQISGIKPKHSTAGGTSDARHMAPLGIDVIEFGVINDTIH 339 ***************9899************************************************** PP TIGR01246 346 kvneavkiedleklsevyeklle 368 ++ne+++ ++++kl+ev+++l+ lcl|NCBI__GCF_000012965.1:WP_011373074.1 340 AINERTTKDEVKKLYEVFKHLID 362 *******************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (365 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.59 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory