Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_011423473.1 RHE_RS00390 2-hydroxyacid dehydrogenase
Query= BRENDA::Q9I6H5 (409 letters) >NCBI__GCF_000092045.1:WP_011423473.1 Length = 336 Score = 90.5 bits (223), Expect = 7e-23 Identities = 76/238 (31%), Positives = 116/238 (48%), Gaps = 25/238 (10%) Query: 92 NAARERGIAVFNAPYSNTRSVAELVLAEAILLLRGIPEKNASCHRGGWI--KSAANSFEI 149 +A E GIAV +A +N VAE LA I K A R ++ ++ ++ + Sbjct: 93 DAIFEAGIAVSHAAEANAVPVAEFTLAAIIFA-----GKRAFRFRDLYVGDRNRDRTYPM 147 Query: 150 R-------GKKLGIVGYGSIGTQLSVLAEALGMQVFFYDTVTKLPLGNAVQIGS----LH 198 + G+ LGIVG IG ++ L + ++ +D + L A +G+ L Sbjct: 148 QREAIGNYGRTLGIVGASRIGRRVIELLKPFDYKLLLFDPM--LDAAEAAGLGAEKVDLD 205 Query: 199 ELLGMSDIVSLHVPELPSTQWMIGEKEIRAMKKGGILINAARGTVVELDHLAAAIKDEHL 258 EL+ +D+VSLH P LPSTQ MI + + MK G LIN ARG +++ L + +K Sbjct: 206 ELMRRADLVSLHAPSLPSTQHMIDARRLSLMKDGATLINTARGILIDEAALLSELKTGR- 264 Query: 259 IGAAIDVFPVEPKSNDEEFASPLRGLDRVILTPHIGGSTAEAQANIGLEVAEKLVKYS 316 I A IDV E E S L V LTPHI G+ +A +G A+++ +++ Sbjct: 265 IDAVIDVTDPE----IPEAGSAFYDLPNVFLTPHIAGAIGLERARLGAMAADEVERFT 318 Lambda K H 0.317 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 409 Length of database: 336 Length adjustment: 30 Effective length of query: 379 Effective length of database: 306 Effective search space: 115974 Effective search space used: 115974 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory