Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (uncharacterized)
to candidate WP_011423937.1 RHE_RS02870 pyridoxal phosphate-dependent aminotransferase
Query= curated2:B1I544 (392 letters) >NCBI__GCF_000092045.1:WP_011423937.1 Length = 388 Score = 147 bits (371), Expect = 5e-40 Identities = 113/380 (29%), Positives = 174/380 (45%), Gaps = 7/380 (1%) Query: 9 IRNLPPYLFARIEQLIAD--KKAQGVD-VISLGIGDPDVPTPDHIIEAAEKELKIPANHQ 65 + +L P A E I + A+G + ++ L +G+ D+PTPD I AA + L Sbjct: 4 VESLSPRAIAAPESGIVEVVNYARGREGLLPLWVGEGDLPTPDFISRAAMEALAAGETF- 62 Query: 66 YPSSAGMPAYRRAVADWYARRFGVELDPQREVVSLIGSKEGIAHLPWCFVDPGDVVLVPD 125 Y G+P RRA++D+Y R F + L + V+ G + I PGD + Sbjct: 63 YTWQRGIPELRRALSDYYVRHFSLRLPAEHFYVTGSGM-QAIQICVQALTSPGDEFVYLT 121 Query: 126 PGYPVYAGGTILAGGIPHPVPLT-AGNGFLPDLAAIPAETARRAKVMFINYPNNPTGAVA 184 P +P A +AG V L G + DL A + + +FIN P+NPTG A Sbjct: 122 PAWPNIAAALEIAGARSVGVTLQFEGGKWTVDLERAEAAITSKTRGIFINTPSNPTGWTA 181 Query: 185 SKEFFARVVDFAREYGILVCHDAAYSEIAFDGYRPPSFLEVAGAREVGIEFHSVSKTYNM 244 +K+ ++ AR++ + + D Y+ F G R SFL+V + + +S SK ++M Sbjct: 182 TKKDLDDILALARKHDLWIMADEIYARYHFAGGRAASFLDVMEPDDKIVFVNSFSKNWSM 241 Query: 245 TGWRAGWAAGNAGAVEALGRLKSNLDSGVFQVVQYAAIAALNGPQDGVQSLCEMYRERRD 304 TGWR GW + L L SGV Q +Q A+AAL+ D V + RD Sbjct: 242 TGWRVGWIVAPPEMGQVLENLVQYSTSGVAQFMQKGAVAALDQGDDFVAANIARAARSRD 301 Query: 305 LVVDTLNDLGWRLT-RPRATFYIWAPVPAGHDASSFAEMVLEKAGVVITPGTGYGTYGEG 363 ++ D L T +P Y + + D+ S A +++K GV + PG +G GE Sbjct: 302 ILCDALIATNRVETLKPDGAIYAFLKIDGVADSRSAAIDIVDKTGVGLAPGAAFGAGGEL 361 Query: 364 YFRISLTLPTPRLVEAMERL 383 + R ++ A ERL Sbjct: 362 FLRACFLRDPAQVAIAAERL 381 Lambda K H 0.321 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 388 Length adjustment: 31 Effective length of query: 361 Effective length of database: 357 Effective search space: 128877 Effective search space used: 128877 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory