Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54); chorismate mutase (EC 5.4.99.5) (characterized)
to candidate WP_011425207.1 RHE_RS09855 3-deoxy-8-phosphooctulonate synthase
Query= BRENDA::P39912 (358 letters) >NCBI__GCF_000092045.1:WP_011425207.1 Length = 281 Score = 97.8 bits (242), Expect = 3e-25 Identities = 84/276 (30%), Positives = 131/276 (47%), Gaps = 36/276 (13%) Query: 104 DTIVDIK-GEKIGDGQQRF--------IVGPCAVESYEQVAEVAAAAKKQGIKILRGGAF 154 DT ++K GE G+GQ F I GPC +ES + VA K+ K+ G + Sbjct: 4 DTNSEVKIGE--GEGQVTFSNAGRLSLIAGPCQMESRDHAFMVAGTLKELCAKLGVGLVY 61 Query: 155 KP------RTSPYDFQGLGVE-GLQILKRVADEFDLAVISEIVTPAHIEEALDYIDVIQI 207 K RTS +G+G+E G+++ + EF V++++ T E + IDV+QI Sbjct: 62 KSSFDKANRTSLSAERGIGLEKGMEVFADLKKEFGFPVLTDVHTAEQCAEVAEVIDVLQI 121 Query: 208 GARNMQNFELLKAAGAVKKPVLLKRGLAATISEFINAAEYIMSQGNDQIILCERGIRTYE 267 A + +LL AA + V +K+G + N + + + GN ++LCERG Sbjct: 122 PAFLCRQTDLLIAAARTGRVVNVKKGQFLAPWDMKNVLKKLNASGNPNVLLCERG----A 177 Query: 268 TATRNTL--DISAVPILKQETHLPVFVDVTHST-----------GRRDLLLPTAKAALAI 314 + NTL D+ ++PI+ PV D THS G+R+ + A+AA+A Sbjct: 178 SFGYNTLVSDMRSLPIM-TAMGAPVIFDATHSVAQPGGQGESSGGQREFVETLARAAVAT 236 Query: 315 GADGVMAEVHPDPSVALSDSAQQMAIPEFEKWLNEL 350 G GV E H DP A SD + + + + L +L Sbjct: 237 GIAGVFLETHQDPDNAPSDGPNMVYLKDMPRLLEKL 272 Lambda K H 0.316 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 281 Length adjustment: 27 Effective length of query: 331 Effective length of database: 254 Effective search space: 84074 Effective search space used: 84074 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory