Align Argininosuccinate synthase; Citrulline--aspartate ligase; EC 6.3.4.5 (characterized)
to candidate WP_011427116.1 RHE_RS20070 argininosuccinate synthase
Query= SwissProt::P59846 (400 letters) >NCBI__GCF_000092045.1:WP_011427116.1 Length = 407 Score = 491 bits (1265), Expect = e-143 Identities = 248/390 (63%), Positives = 298/390 (76%), Gaps = 3/390 (0%) Query: 2 KIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQGEEVEEAREKALRTGASKAIALDL 61 K+VLAYSGGLDTSIILKWL+ AEV+ FTAD+GQGEE+E AR+KA G + D+ Sbjct: 9 KVVLAYSGGLDTSIILKWLQTELGAEVVTFTADLGQGEELEPARKKAEMLGIKEIYIEDV 68 Query: 62 KEEFVRDFVFPMMRAGAVYEGYYLLGTSIARPLIAKHLVRIAEEEGAEAIAHGATGKGND 121 +EEFVRDFVFPM RA AVYEG YLLGTSIARPLI+KHL+ IA + GA+AIAHGATGKGND Sbjct: 69 REEFVRDFVFPMFRANAVYEGVYLLGTSIARPLISKHLIDIARKTGADAIAHGATGKGND 128 Query: 122 QVRFELTAYALKPDIKVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQ--EKPYSMDANLL 179 QVRFEL+AYAL PDIK+IAPWR+W+F+ R E++A+AE H IPV + E P+S+DANLL Sbjct: 129 QVRFELSAYALNPDIKIIAPWRDWAFKSRTELLAFAEQHQIPVAKDKKGEAPFSVDANLL 188 Query: 180 HISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVEFFEGDPVAVNGERLSPAALL 239 H S EG VLEDP E P+ + T PE APD ++V F +GD V++NG +SPA LL Sbjct: 189 HSSSEGKVLEDPAQEAPEYVHMRTISPEAAPDKATVIKVGFRKGDAVSINGVEMSPATLL 248 Query: 240 QRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGGTILYHARRAVESLTLDREVLHQRD 299 LN G +G+GR+D+VENRFVGMKSRGVYETPGGTIL A RA+ES+TLDR H +D Sbjct: 249 ATLNTYGRDNGIGRLDLVENRFVGMKSRGVYETPGGTILLSAHRAIESITLDRGAAHLKD 308 Query: 300 MLSPKYAELVYYGFWYAPEREALQAYFDHVARSVTGVARLKLYKGNVYVVGRKAPKSLYR 359 + P+YAEL+YYGFW++PERE LQA D V G LKLYKGNV V+GR++ KSLY Sbjct: 309 EIMPRYAELIYYGFWFSPEREMLQALIDKSQEYVEGEVTLKLYKGNVMVIGRESEKSLYS 368 Query: 360 QDLVSF-DEAGGYDQKDAEGFIKIQALRLR 388 LV+F D+ G YDQKDA GFIK+ ALRLR Sbjct: 369 DKLVTFEDDQGAYDQKDAAGFIKLNALRLR 398 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 407 Length adjustment: 31 Effective length of query: 369 Effective length of database: 376 Effective search space: 138744 Effective search space used: 138744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_011427116.1 RHE_RS20070 (argininosuccinate synthase)
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.15294.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-145 470.1 0.0 4.6e-145 469.8 0.0 1.0 1 lcl|NCBI__GCF_000092045.1:WP_011427116.1 RHE_RS20070 argininosuccinate sy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000092045.1:WP_011427116.1 RHE_RS20070 argininosuccinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 469.8 0.0 4.6e-145 4.6e-145 1 389 [. 9 400 .. 9 404 .. 0.97 Alignments for each domain: == domain 1 score: 469.8 bits; conditional E-value: 4.6e-145 TIGR00032 1 kvvlaysGGlDtsvalklleek.gaeviavtvdvGqpeedldaieekalklGaekayviDareefvkdy 68 kvvlaysGGlDts++lk+l+ + gaev+++t+d+Gq+ e+l+ +++ka lG ++ y+ D reefv+d+ lcl|NCBI__GCF_000092045.1:WP_011427116.1 9 KVVLAYSGGLDTSIILKWLQTElGAEVVTFTADLGQG-EELEPARKKAEMLGIKEIYIEDVREEFVRDF 76 8***********************************9.9****************************** PP TIGR00032 69 lfaaiqanavyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdlkv 137 +f+ +anavyeg+Yll+t++aRpli+k l+++a+k ga+a+ahG+tgKGnDqvRFels ++lnpd+k+ lcl|NCBI__GCF_000092045.1:WP_011427116.1 77 VFPMFRANAVYEGVYLLGTSIARPLISKHLIDIARKTGADAIAHGATGKGNDQVRFELSAYALNPDIKI 145 ********************************************************************* PP TIGR00032 138 iaPvreleli.ReeeieyaaekGievpvek..ekaysiDenllgrsiEageLEdpsteppediyelvkd 203 iaP+r++ + R+e++++a+++ i+v+ +k e ++s+D nll+ s E++ LEdp e pe +++ + + lcl|NCBI__GCF_000092045.1:WP_011427116.1 146 IAPWRDWAFKsRTELLAFAEQHQIPVAKDKkgEAPFSVDANLLHSSSEGKVLEDPAQEAPEYVHMRTIS 214 *********88***************988744689*********************************8 PP TIGR00032 204 piektedepevveieFekGvPvalngeslepvelilkaneiagkhGvGriDivEdRiiglKsReiYEap 272 p++++ d++ v++++F+kG v++ng++++p +l+ ++n ++ +G+Gr+D vE+R +g+KsR++YE+p lcl|NCBI__GCF_000092045.1:WP_011427116.1 215 PEAAP-DKATVIKVGFRKGDAVSINGVEMSPATLLATLNTYGRDNGIGRLDLVENRFVGMKSRGVYETP 282 88877.*************************************************************** PP TIGR00032 273 alllLikAhkdLetlvltkdvlefkeiveekyseliYkGlwfdplaealdalikktqervtGtvrvklf 341 + ++L++Ah+++e+ +l++ +++k+ + +y+eliY+G+wf+p++e+l+ali+k+qe v G+v++kl+ lcl|NCBI__GCF_000092045.1:WP_011427116.1 283 GGTILLSAHRAIESITLDRGAAHLKDEIMPRYAELIYYGFWFSPEREMLQALIDKSQEYVEGEVTLKLY 351 ********************************************************************* PP TIGR00032 342 kGnaivigrkseyslYdeelvsfek.dkefdqkdaiGfikirglqikvy 389 kGn++vigr+se+slY+++lv+fe + ++dqkda+Gfik+++l+ ++ lcl|NCBI__GCF_000092045.1:WP_011427116.1 352 KGNVMVIGRESEKSLYSDKLVTFEDdQGAYDQKDAAGFIKLNALRLRTL 400 ************************955689**************98765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (407 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.82 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory