Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95 (uncharacterized)
to candidate WP_011428685.1 RHE_RS28405 dehydrogenase
Query= curated2:Q58424 (524 letters) >NCBI__GCF_000092045.1:WP_011428685.1 Length = 324 Score = 175 bits (443), Expect = 3e-48 Identities = 110/314 (35%), Positives = 172/314 (54%), Gaps = 11/314 (3%) Query: 4 ILVTDPLHEDAIKILEEVGEVEVATGLTKEELLEKIKDADVLVVRSGTKVTRDVIEKAEK 63 I T PLH A +L+ G++ +A+ E LL + + A +++VR+ + E A Sbjct: 4 IFSTHPLHPAAKAMLQGAGDLRIASAPDPETLLREGRGAGIVIVRA--PIPPVFFEDAPA 61 Query: 64 LKVIGRAGVGVDNIDVEAATEKGIIVVNAPDASSISVAELTMGLMLAAARNIPQATASLK 123 L+ R G G+D + +EAAT G++V N P ++ +VAE + LA R Q L+ Sbjct: 62 LRAAIRHGAGLDMVPMEAATRAGVLVANVPGVNASTVAEHVFLVTLALLRRFRQMDGDLR 121 Query: 124 RGEWDRKRFKG---IELYGKTLGVIGLGRIGQQVVKRAK-AFGMNIIGYDPYIPKEVAES 179 + W R + ++L G+T+G++G+G +G+ + K AK FG+ ++ P V E Sbjct: 122 QNGWAAGRAQADAAVDLGGRTMGIVGMGNVGKAIFKIAKFGFGLEVVATSRS-PGSVPEG 180 Query: 180 MGVELVDDINELCKRADFITLHVPLTPKTRHIIGREQIALMKKNAIIVNCARGGLIDEKA 239 +D EL AD + L PLTP T ++ +IA M+ +AI+VN +RG ++D+ A Sbjct: 181 ARFLTID---ELVALADILVLCCPLTPGTTGLLHAGRIARMRPDAILVNVSRGPVVDDAA 237 Query: 240 LYEALKEGKIRAAALDVFEEEP-PKDNPLLTLDNVIGTPHQGASTEEAQKAAGTIVAEQI 298 L EAL+ G+I AALDVF +P P D+P NVI TPH TEE+ GT A + Sbjct: 238 LIEALRGGRIGGAALDVFATQPLPLDHPYFGFANVIVTPHLAGLTEESMMRMGTGAASEA 297 Query: 299 KKVLRGELAENVVN 312 +V++G+L N+ N Sbjct: 298 LRVIKGDLPVNLRN 311 Lambda K H 0.316 0.137 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 524 Length of database: 324 Length adjustment: 31 Effective length of query: 493 Effective length of database: 293 Effective search space: 144449 Effective search space used: 144449 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory