Align Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate WP_011445667.1 SARO_RS10155 triose-phosphate isomerase
Query= SwissProt::Q8L1Z5 (254 letters) >NCBI__GCF_000013325.1:WP_011445667.1 Length = 256 Score = 210 bits (535), Expect = 2e-59 Identities = 116/250 (46%), Positives = 158/250 (63%), Gaps = 14/250 (5%) Query: 6 RPFIAGNWKMNGTGESLGELRAI--AAGISSDLGRLFEALICVPATLLSRAFDILGGENI 63 RP+I GNWKMNG+ L E RAI AAG D+ + I P TL+ + + + Sbjct: 4 RPYIVGNWKMNGSRAMLAEARAIDRAAGRYPDV----QVAIAPPFTLIGALREAVSAMGV 59 Query: 64 LLGGQNCHFDDYGPYTGDISAFMLKEAGASHVIIGHSERRTVYQESDAIVRAKVQAAWRA 123 GGQ+CH + G +TGD+SA ML + GA I+GHSERR + E+DA+V+AK +AA A Sbjct: 60 --GGQDCHTEVKGAHTGDVSAAMLVDTGADFAILGHSERRKDHGENDALVKAKAEAALTA 117 Query: 124 GLVALICVGETLEERKSNKVLDVLTRQLEGSLPDGATAE------NIIIAYEPVWAVGTG 177 GL ++CVGETL++R + K V++ Q++GSLP TA + +AYEPVWA+GTG Sbjct: 118 GLDIIVCVGETLDQRDAGKAEAVVSSQVDGSLPSPETAAEAVAAGKVAVAYEPVWAIGTG 177 Query: 178 NTATSADVAEVHAFIHHKMHSRFGDEGAKIRLLYGGSVKPSNAFELLSTAHVNGALIGGA 237 A DV +HA I ++ + +G+ G+K+R+LYGGSV NA ELL+ V GAL+GGA Sbjct: 178 RVAAVEDVVTMHAAIRARLVALYGESGSKVRILYGGSVNSGNAAELLAADGVGGALVGGA 237 Query: 238 SLKAIDFLTI 247 SL A FL I Sbjct: 238 SLTAEAFLPI 247 Lambda K H 0.320 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 256 Length adjustment: 24 Effective length of query: 230 Effective length of database: 232 Effective search space: 53360 Effective search space used: 53360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_011445667.1 SARO_RS10155 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00419.hmm # target sequence database: /tmp/gapView.18447.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-55 173.8 5.6 3.2e-55 173.4 5.6 1.1 1 lcl|NCBI__GCF_000013325.1:WP_011445667.1 SARO_RS10155 triose-phosphate is Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000013325.1:WP_011445667.1 SARO_RS10155 triose-phosphate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 173.4 5.6 3.2e-55 3.2e-55 2 228 .] 7 242 .. 6 242 .. 0.91 Alignments for each domain: == domain 1 score: 173.4 bits; conditional E-value: 3.2e-55 TIGR00419 2 viinfKlnesvgkvelevaklaeevaseagvevavappfvdldvvkdeveseiqvaAqnvdavksGaft 70 +++n+K+n+s+ + ++ + + +v+va+appf + ++++v+ + v+ q++++ +Ga+t lcl|NCBI__GCF_000013325.1:WP_011445667.1 7 IVGNWKMNGSRAMLAEA-RAIDRAAGRYPDVQVAIAPPFTLIGALREAVS-AMGVGGQDCHTEVKGAHT 73 89**********99865.66888888899****************99999.99**************** PP TIGR00419 71 GeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleere.......aa 132 G++sA+ml+d+Ga + ++gHsErR + e d l+++k + gl +vCvgetl++r+ ++ lcl|NCBI__GCF_000013325.1:WP_011445667.1 74 GDVSAAMLVDTGADFAILGHSERRKDHGENDALVKAKAEAALTAGLDIIVCVGETLDQRDagkaeavVS 142 ************************************************************666666644 PP TIGR00419 133 rtinnv....attaaaaAlepdvvAvEPveliGtGkpvskAeaevveksvrdhlkkvskevaesvrvly 197 ++++ t a+a+A ++ vA+EPv++iGtG++++ + +++ +r l e +vr+ly lcl|NCBI__GCF_000013325.1:WP_011445667.1 143 SQVDGSlpspETAAEAVAAGKVAVAYEPVWAIGTGRVAAVEDVVTMHAAIRARLVALYGESGSKVRILY 211 55554311114566788899************************************************* PP TIGR00419 198 GasvtaaedaelaaqldvdGvLlasavlkae 228 G+sv+++++ael a +v G+L+++a+l ae lcl|NCBI__GCF_000013325.1:WP_011445667.1 212 GGSVNSGNAAELLAADGVGGALVGGASLTAE 242 ****************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (256 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 6.45 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory