Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate WP_011445875.1 SARO_RS11225 carbamoyl-phosphate synthase small subunit
Query= SwissProt::P0A6F1 (382 letters) >NCBI__GCF_000013325.1:WP_011445875.1 Length = 391 Score = 348 bits (894), Expect = e-100 Identities = 195/375 (52%), Positives = 241/375 (64%), Gaps = 10/375 (2%) Query: 4 SALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNV 63 + +LVL DG+ GR GA G+AVGEV FNT+MTGYQE++TDPSY+ Q+VT T+PHIGNV Sbjct: 16 TGVLVLADGSVAWGRGFGAAGAAVGEVCFNTAMTGYQEVMTDPSYAGQVVTFTFPHIGNV 75 Query: 64 GTNDADEESSQVH-AQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLL 122 GTN D ES A G V+R+ +NFR ++++ + I+ +DTR LTR + Sbjct: 76 GTNPDDMESHDTPGAVGCVVREDVTAPANFRAAGTFQQWMEQQGKIGISGLDTRALTRRI 135 Query: 123 REKGAQNGCIIAGDNP---DAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTG 179 R GA N +IA D D +E+AR++PGL GMDLA+ VT +W W L Sbjct: 136 RLSGAPNA-VIAHDPKGQFDIPALIERARSWPGLEGMDLARVVTRDGQEAWEGSVWHLGE 194 Query: 180 GLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLS 239 G K + HVVA DFGAK NI R LV G +TIVPA+TS E +L + P G+FLS Sbjct: 195 GF--TKPQGTGRPHVVAMDFGAKDNIFRNLVKAGADVTIVPAETSLETILSLKPAGVFLS 252 Query: 240 NGPGDPAPCD-YAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVK 298 NGPGDPA YA+ IQK LE D+PVFGICLGHQ+LALA+GA+T KM GH G NHPVK Sbjct: 253 NGPGDPAATGAYAVPVIQKLLEMDMPVFGICLGHQMLALAAGARTTKMHQGHRGANHPVK 312 Query: 299 DVEKNVVMITAQNHGFAVDEA--TLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEA 356 +E VV IT+ NHGFAVD A L + TH SLFDG+ GI K AF Q HPEA Sbjct: 313 RIEDGVVEITSMNHGFAVDNAPGALGDKVIETHVSLFDGSNCGIAVKGKKAFGVQYHPEA 372 Query: 357 SPGPHDAAPLFDHFI 371 SPGP D+ LF+ F+ Sbjct: 373 SPGPQDSFYLFEKFV 387 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 477 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 391 Length adjustment: 30 Effective length of query: 352 Effective length of database: 361 Effective search space: 127072 Effective search space used: 127072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_011445875.1 SARO_RS11225 (carbamoyl-phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.1405.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-128 412.1 0.0 1.1e-127 411.9 0.0 1.0 1 lcl|NCBI__GCF_000013325.1:WP_011445875.1 SARO_RS11225 carbamoyl-phosphate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000013325.1:WP_011445875.1 SARO_RS11225 carbamoyl-phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 411.9 0.0 1.1e-127 1.1e-127 2 358 .. 18 389 .. 17 391 .] 0.93 Alignments for each domain: == domain 1 score: 411.9 bits; conditional E-value: 1.1e-127 TIGR01368 2 tlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaesk. 69 +lvl+dG+v g++fga + +vGev+FnT+mtGYqE++tDpsY+gq+v++t p+ign+g+n++d+es+ lcl|NCBI__GCF_000013325.1:WP_011445875.1 18 VLVLADGSVAWGRGFGAAGAAVGEVCFNTAMTGYQEVMTDPSYAGQVVTFTFPHIGNVGTNPDDMESHd 86 69*****************************************************************96 PP TIGR01368 70 kikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavistekse...k 135 ++ + g vv+e +++ n+ra +++++++++g ++i g+DTRal++++R +g+ +avi+++ + lcl|NCBI__GCF_000013325.1:WP_011445875.1 87 TPGAVGCVVREDVTAPANFRAAGTFQQWMEQQGKIGISGLDTRALTRRIRLSGAPNAVIAHDPKGqfdI 155 899*********************************************************998764446 PP TIGR01368 136 eelvekakespkvkevnlvkevstkeayeleq......k..akkegkk.lrvvvidlGvKenilreLvk 195 l+e+a++ p +++++l++ v+ + + ++e + +k +g+ +vv++d+G K ni r+Lvk lcl|NCBI__GCF_000013325.1:WP_011445875.1 156 PALIERARSWPGLEGMDLARVVTRDGQEAWEGsvwhlgEgfTKPQGTGrPHVVAMDFGAKDNIFRNLVK 224 78899999***********99999999999986665551664444443479****************** PP TIGR01368 196 rgvevtvvpadtsaeeikklnpdgillsnGPGdPaav.eeaietvkklleakiPifGIclGhqllalal 263 g++vt+vpa+ts+e+i +l+p g++lsnGPGdPaa +a+ ++klle ++P+fGIclGhq+lala+ lcl|NCBI__GCF_000013325.1:WP_011445875.1 225 AGADVTIVPAETSLETILSLKPAGVFLSNGPGDPAATgAYAVPVIQKLLEMDMPVFGICLGHQMLALAA 293 **********************************8772678999************************* PP TIGR01368 264 gaktyklkfGhrGaNhpvkdlktgrveitsqNHgyavdees.lkeeelevthvnlnDgtveglehkelp 331 ga+t k++ GhrGaNhpvk +++g veits NHg+avd++ +++ thv+l+Dg++ g++ k ++ lcl|NCBI__GCF_000013325.1:WP_011445875.1 294 GARTTKMHQGHRGANHPVKRIEDGVVEITSMNHGFAVDNAPgALGDKVIETHVSLFDGSNCGIAVKGKK 362 **************************************985456789********************** PP TIGR01368 332 vfsvQyHPeaspGphdteylFdefvel 358 +f vQyHPeaspGp+d+ ylF++fv lcl|NCBI__GCF_000013325.1:WP_011445875.1 363 AFGVQYHPEASPGPQDSFYLFEKFVAS 389 ************************975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.58 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory