Align Phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_011446022.1 SARO_RS11975 D-2-hydroxyacid dehydrogenase
Query= reanno::SB2B:6938941 (308 letters) >NCBI__GCF_000013325.1:WP_011446022.1 Length = 307 Score = 120 bits (301), Expect = 4e-32 Identities = 92/268 (34%), Positives = 137/268 (51%), Gaps = 19/268 (7%) Query: 51 APLVNHASGLRWMQSTFAGVDLLVKPRQR-RDYLLTNVRGIFGPLMSEYL-FGYLLARQR 108 A + A+ L+W+ S +AGVD + R R +LTN GI ++EY+ G L + Sbjct: 49 AKAIRSATKLKWLNSIYAGVDAMPLDLLRERGVVLTNGVGINAITIAEYVVMGMLTVAKG 108 Query: 109 EHDLYKSQQQQKLWL---PGSYKTLQGSELLLLGTGSIAKHLAQTAKHFGMKVAGINRSA 165 ++ ++Q++ + WL PG + L GS L+LG G+I + + + + F + VA + RS Sbjct: 109 YREVVRAQERHE-WLMDSPGKVE-LHGSRALVLGYGAIGQRVERMLQAFDVDVAKVRRSG 166 Query: 166 KATE-GFDEVATLEALPTLMARADAIASILPSTEATRGILNENILARMKPDAVLFNLGRG 224 A G DE + + D + +P+T T G++ LA MKP A L N+ RG Sbjct: 167 GAGALGPDEWRSQ------LGTFDWVILAVPATAETEGMIGAAELAAMKPTATLINVARG 220 Query: 225 DVLDLDALERQLRQHPQQQAVLDVFNQEPLPEDHPIWGLGNVIVTPHIAAPS----FPEQ 280 V+D +AL L QA LDV + EPLP DHP+W L N VT H++ + F Sbjct: 221 TVVDQEALVVALSAGRPGQAFLDVTSPEPLPADHPLWSLPNAHVTMHLSGRAQTRMFERS 280 Query: 281 VAEIFSSNYHKFLLGETLSHRVNFERGY 308 VA F N +F GE L +V+ GY Sbjct: 281 VAR-FLENLARFRRGEPLEPQVDLALGY 307 Lambda K H 0.320 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 307 Length adjustment: 27 Effective length of query: 281 Effective length of database: 280 Effective search space: 78680 Effective search space used: 78680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory