Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_011459619.1 DHAF_RS11905 aminotransferase class V-fold PLP-dependent enzyme
Query= metacyc::MONOMER-21143 (387 letters) >NCBI__GCF_000021925.1:WP_011459619.1 Length = 387 Score = 201 bits (512), Expect = 2e-56 Identities = 116/385 (30%), Positives = 208/385 (54%), Gaps = 11/385 (2%) Query: 3 LAKNLQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGHHG 62 +A NL G F +++ K + I LG+G+PDF TP V ++ +L++G Sbjct: 8 IAANLPPSGIRKFFDLVSTMKNV-------ISLGVGEPDFVTPWTVRESGIFSLEQGQTM 60 Query: 63 YVLSNGILECRQAVTRKIKKLYNKDIDP-ERVLIMPGGKPTMYYAIQCFGEPGAEIIHPT 121 Y ++G+LE RQA++ ++K + +P + +LI G + A++ PG ++ Sbjct: 61 YTSNSGLLELRQALSWNMEKKLGLEYNPNDEILITVGASEAVDLAMRALLGPGDALLLTD 120 Query: 122 PAFPIYESMINYTGSTPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFVE 181 PA+ Y G+ E++D + E + + T ++L+L PNNPTG+ + Sbjct: 121 PAYVSYGPCATLAGAEVHYVPTREEEDFRVRVEDLERVYTPNAKVLVLSYPNNPTGAIMT 180 Query: 182 KSAIDVLAEGLKKHPHVAILSDEIYSRQIYDGKEMPTFFNYPDLQDRLIVLDGWSKAYAM 241 +A+ ++ H + +++DEIYS Y G F + P++++R + + G+SK+YAM Sbjct: 181 WEDYQPIAKFVQDHDLI-VVADEIYSDLSYGGSHT-AFASLPNMRNRTLHISGFSKSYAM 238 Query: 242 TGWRMGWSVWPEELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQRRK 301 TGWR+G+ + I + ++ ++ C +Q A + A+ + A+ +M+ +D+RR+ Sbjct: 239 TGWRIGYVAGHHDFIQAMTRIHQYTMLCAPITAQLAALEAVRSAEQAMQDMVATYDRRRR 298 Query: 302 LIHEGLNSLPGVECSLPGGAFYAFPKVIGTGMNGSEFAKKCMHEAGVAIVPGTAFGKTCQ 361 L+ G + G+ C P GAFY FP + TG+ EFA + + E VA+VPGTAFG + + Sbjct: 299 LMVHGFRKM-GLSCFEPLGAFYTFPSIKATGLTSEEFANELLQEEKVAVVPGTAFGPSGE 357 Query: 362 DYVRFSYAASQDNISNALENIKKML 386 ++R SYA S + I AL +++ + Sbjct: 358 GHIRCSYAYSTEQIQEALTRMERFV 382 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 364 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 387 Length adjustment: 30 Effective length of query: 357 Effective length of database: 357 Effective search space: 127449 Effective search space used: 127449 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory