Align Aromatic-amino-acid aminotransferase (EC 2.6.1.57) (characterized)
to candidate WP_011605448.1 FRAAL_RS18885 PLP-dependent aminotransferase family protein
Query= reanno::acidovorax_3H11:Ac3H11_1015 (396 letters) >NCBI__GCF_000058485.1:WP_011605448.1 Length = 401 Score = 313 bits (802), Expect = 6e-90 Identities = 174/396 (43%), Positives = 231/396 (58%), Gaps = 11/396 (2%) Query: 2 QFADRLNNVETSAIRELFKLLGKPGIISFAGGFPDSAMFDVEGIRAASNAALAEEPGAAL 61 Q A R V TS +RE+ L +P +ISFAGG P + D +GIR A + L +EP L Sbjct: 9 QLAARARAVRTSPVREILALTARPEVISFAGGLPAPELIDADGIRRAYDQVLTDEPRRVL 68 Query: 62 QYGATEGYNPLREQLAAFMTSKGAKDVAADNLIVTTGSQQALDLLGKTLISPGDKVIVEG 121 QY TEG LR +AA + +G D+L+VTTGSQQAL LL L+ PGD V+VE Sbjct: 69 QYSTTEGDPDLRAAVAARLARRGLP-TEPDHLLVTTGSQQALTLLAAALLEPGDAVVVED 127 Query: 122 PTFLATIQCFRLYGAELISAPIDGNGVKTDELEKLIAEHKPKFVYLIPTFGNPSGAMLSL 181 PT+LA +QCF GA + +AP D G+ D L L+A +P+ +Y++PTF NP+G ++ Sbjct: 128 PTYLAVLQCFGFAGARVFAAPTDDQGIIPDRLADLVARERPRLLYVVPTFQNPTGRTMAA 187 Query: 182 ERRKAVLEMAVKHNTLIVEDDPYGDL-YFGDAPPPSLLNLSATVPGSRELLVHCGSLSKV 240 +RR+AV E+A + IVEDDPYG+L Y G A P A+ P + + V GS SK Sbjct: 188 DRRRAVAEVAARQGLWIVEDDPYGELRYEGTAQP-----WIASYPAAADRTVLLGSFSKT 242 Query: 241 LSPGLRVGWMIAPAELLGKATMCKQFSDAHTSTFAQATAAQYLKAGRMPGTLANVRKVYA 300 ++PG+R+GW+ APA L + KQ +D HTST QA AA+YL + LA + VY Sbjct: 243 MAPGMRLGWLRAPAALRRACVIAKQAADLHTSTVDQAAAARYLAEADLDAHLARMCAVYR 302 Query: 301 ERAQAMGDALRKELGDAIEFVQPQGGLFVWARLTGAGGKVADGNVLAKRAIEKGVAFVPG 360 ER AM D L L + +P+GG+FVWARL D L + VA+VPG Sbjct: 303 ERRDAMLDGLVGALPPGSSWNRPEGGMFVWARLPAG----YDATALLPAVVAHDVAYVPG 358 Query: 361 TPFFCANPDHATFRLSFATADVDKIREGVARLGQAV 396 PFF PD A RLSF T +I EG+ARL +A+ Sbjct: 359 APFFAGAPDPAALRLSFTTHAPARIAEGMARLARAL 394 Lambda K H 0.319 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 401 Length adjustment: 31 Effective length of query: 365 Effective length of database: 370 Effective search space: 135050 Effective search space used: 135050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory