Align Serine O-succinyltransferase; SST; Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.-; EC 2.3.1.46 (characterized)
to candidate WP_011605485.1 FRAAL_RS19070 homoserine O-acetyltransferase
Query= SwissProt::A0A0I9RJ56 (370 letters) >NCBI__GCF_000058485.1:WP_011605485.1 Length = 423 Score = 233 bits (594), Expect = 7e-66 Identities = 149/381 (39%), Positives = 206/381 (54%), Gaps = 38/381 (9%) Query: 10 RFHALPSPFPFKRGGALHGARVAYETWGTLAADASNAILIVTGLSPDAHAA--ANDANPA 67 RF LP P +RGGAL G RVAYETWG L ADA NA+L++ L+ D+HAA A +P+ Sbjct: 61 RFAELPGPLRLERGGALAGVRVAYETWGRLDADAGNAVLVLHALTGDSHAAGPAEPGHPS 120 Query: 68 AGWWEGMVGPGKAIDTDRWFVVCVNSLGSCRGSTGPASLNPATGQPYRLDFPELSIEDGA 127 AGWW+G++GPG+A+DTDR FVV N LG C+G+TGPA+ P G+P+ +PE++I D Sbjct: 121 AGWWDGLIGPGRALDTDRLFVVSPNVLGGCQGTTGPATTAP-DGRPWGGRWPEITIADQV 179 Query: 128 RAAIEVVRAQGIEQLACVVGNSMGGMTALAVLMLHPGIARSHVNISGSAQALPFSIAIRS 187 A + V A G+ + A VVG SMGGM AL + HP V ++ A A I + + Sbjct: 180 AAEVAVADALGVRRWAAVVGGSMGGMRALEWAVGHPDRVGRVVVLACGATATAEQIGLYA 239 Query: 188 LQREAIRLDPRWNGGHY-----------------DDDAYPESGMRMARKLGVITYRSALE 230 +Q AI DP W+GG Y D P +GM +AR++ I+YRS E Sbjct: 240 VQVRAITDDPGWHGGDYYRLPTGQRLTAETGRGPDAGTGPAAGMGLARRMAQISYRSEEE 299 Query: 231 WDGRF-GRVRLDSDQTDDDPFGLEFQVESYLEGHARRFVRFFDPNCYLYLSRSMDWFDLA 289 + RF R R D +F+V SYL+ HA + R FD Y+ L+R+M D+ Sbjct: 300 LEDRFAARTRADG----------QFEVASYLDHHAGKLARRFDAGSYVTLTRAMMTQDVG 349 Query: 290 EYADGDVLAGLAKIRVEKALAIGANTDILFPVQQQQQVADGLRAGGADARFIGLESPQGH 349 G A L V +A G ++D L+P++ QQ +A G R + S GH Sbjct: 350 R-GRGGFAAALRACPVPFTVA-GVDSDRLYPLRLQQDIA---TLTGVPLRVV--HSRSGH 402 Query: 350 DAFLVDFERFCPAVRGFLDAL 370 D FL + ++ V L A+ Sbjct: 403 DGFLTETDQVAALVHEALGAI 423 Lambda K H 0.322 0.138 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 423 Length adjustment: 31 Effective length of query: 339 Effective length of database: 392 Effective search space: 132888 Effective search space used: 132888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory