Align 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) (characterized)
to candidate WP_011606825.1 FRAAL_RS25050 4-hydroxy-tetrahydrodipicolinate reductase
Query= BRENDA::P9WP23 (245 letters) >NCBI__GCF_000058485.1:WP_011606825.1 Length = 244 Score = 300 bits (767), Expect = 2e-86 Identities = 157/245 (64%), Positives = 188/245 (76%), Gaps = 5/245 (2%) Query: 3 VGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNL 62 +GVLGA+G++G+T+ AV AA DL L A +DAGD + L +VV+DFT PD V+ N+ Sbjct: 1 MGVLGARGRMGSTVCAAVEAAGDLALVAAIDAGDDRAALAAA--DVVVDFTTPDAVLDNV 58 Query: 63 EFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFAIGAVLSMHFAKQAARF 122 + ++ G H VVGTTGF ER V WL P VL+APNF + AVL M FA +AARF Sbjct: 59 RWCVEAGRHVVVGTTGFDDERLTTVRGWLGDAPKVGVLVAPNFGVAAVLMMMFAARAARF 118 Query: 123 FDSAEVIELHHPHKADAPSGTAARTAKLIAEARK--GLPPN-PDATSTSLPGARGADVDG 179 FDS E++ELHHP+K DAPSGTA RTA+L+A+AR+ GL P PDAT+T+L GARGA V G Sbjct: 119 FDSVEIVELHHPNKVDAPSGTARRTAELVAQAREAAGLAPGGPDATATALDGARGARVAG 178 Query: 180 IPVHAVRLAGLVAHQEVLFGTEGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLE 239 +PVHAVRLAGLVAHQEVL G GETLT+RHDS DRTSF+PGVLLAVRRIA+RPGLTVGLE Sbjct: 179 VPVHAVRLAGLVAHQEVLLGGAGETLTLRHDSYDRTSFMPGVLLAVRRIADRPGLTVGLE 238 Query: 240 PLLDL 244 LLDL Sbjct: 239 HLLDL 243 Lambda K H 0.319 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 247 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 245 Length of database: 244 Length adjustment: 24 Effective length of query: 221 Effective length of database: 220 Effective search space: 48620 Effective search space used: 48620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
Align candidate WP_011606825.1 FRAAL_RS25050 (4-hydroxy-tetrahydrodipicolinate reductase)
to HMM TIGR00036 (dapB: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00036.hmm # target sequence database: /tmp/gapView.31989.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00036 [M=270] Accession: TIGR00036 Description: dapB: 4-hydroxy-tetrahydrodipicolinate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-65 205.1 0.4 2.4e-58 183.8 0.0 2.0 2 lcl|NCBI__GCF_000058485.1:WP_011606825.1 FRAAL_RS25050 4-hydroxy-tetrahyd Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000058485.1:WP_011606825.1 FRAAL_RS25050 4-hydroxy-tetrahydrodipicolinate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.0 0.4 2e-08 2e-08 5 35 .. 2 32 .. 1 38 [. 0.90 2 ! 183.8 0.0 2.4e-58 2.4e-58 69 270 .] 38 242 .. 33 242 .. 0.93 Alignments for each domain: == domain 1 score: 20.0 bits; conditional E-value: 2e-08 TIGR00036 5 avaGaaGrmGrevikavkeaedlelvaaler 35 +v Ga+GrmG+ v av++a dl+lvaa+++ lcl|NCBI__GCF_000058485.1:WP_011606825.1 2 GVLGARGRMGSTVCAAVEAAGDLALVAAIDA 32 799**************************95 PP == domain 2 score: 183.8 bits; conditional E-value: 2.4e-58 TIGR00036 69 aekkadvliDfttpeavlenvkialekgvrlVvGTTGfseedlkelkdla.ekkgvalviapNfaiGvn 136 a +adv++Dfttp+avl+nv+ ++e+g ++VvGTTGf++e l +++ + +v++++apNf + ++ lcl|NCBI__GCF_000058485.1:WP_011606825.1 38 ALAAADVVVDFTTPDAVLDNVRWCVEAGRHVVVGTTGFDDERLTTVRGWLgDAPKVGVLVAPNFGVAAV 106 55689*****************************************986515568************** PP TIGR00036 137 lllkllekaakvledvDiEiiElHHrhKkDaPSGTAlklaeiiakarg.kdlkeaaveer.egltGerk 203 l++ ++ aa+ ++ v Ei+ElHH +K+DaPSGTA ++ae +a+ar+ l + +l G+r+ lcl|NCBI__GCF_000058485.1:WP_011606825.1 107 LMMMFAARAARFFDSV--EIVELHHPNKVDAPSGTARRTAELVAQAREaAGLAPGGPDATaTALDGARG 173 *************999..******************************777888777654167899999 PP TIGR00036 204 keeiG..iaavRggdvvgehtvlFasdGerleitHkassRaafakGvvrairwledkeekvydledvld 270 + G ++avR++++v++++vl ++ Ge+l+++H++++R++f+ Gv++a+r ++d + +le +ld lcl|NCBI__GCF_000058485.1:WP_011606825.1 174 ARVAGvpVHAVRLAGLVAHQEVLLGGAGETLTLRHDSYDRTSFMPGVLLAVRRIADRPGLTVGLEHLLD 242 99999999*************************************************999999999986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (244 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.01s 00:00:00.04 Elapsed: 00:00:00.04 # Mc/sec: 1.56 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory